KEGG   Streptococcus intermedius B196: SIR_1475Help
Entry
SIR_1475          CDS       T02830                                 

Gene name
aspC
Definition
(GenBank) putative aminotransferase AlaT
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
sib  Streptococcus intermedius B196
Pathway
sib00220  Arginine biosynthesis
sib00250  Alanine, aspartate and glutamate metabolism
sib00290  Valine, leucine and isoleucine biosynthesis
sib01100  Metabolic pathways
sib01110  Biosynthesis of secondary metabolites
sib01130  Biosynthesis of antibiotics
sib01210  2-Oxocarboxylic acid metabolism
sib01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sib00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SIR_1475 (aspC)
   00290 Valine, leucine and isoleucine biosynthesis
    SIR_1475 (aspC)
   00220 Arginine biosynthesis
    SIR_1475 (aspC)
Enzymes [BR:sib01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     SIR_1475 (aspC)
    2.6.1.66  valine---pyruvate transaminase
     SIR_1475 (aspC)
Amino acid related enzymes [BR:sib01007]
 Aminotransferase (transaminase)
  Class I
   SIR_1475 (aspC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 MHC_II_alpha Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AGU76826
UniProt: T1ZGH4
LinkDB All DBs
Position
complement(1542864..1544078)
Genome map
AA seq 404 aa AA seqDB search
MKEFNKSTKLEHVAYDIRGPVLEEAMRMRANGEKILRLNTGNPAEFGFTAPDEVIHDLIM
NARDSEGYSDSKGIFSARKAIMQYCQLKNIPNVDIDDVYLGNGVSELIVMSMQGLLDNGD
EVLVPMPDYPLWTAAVSLAGGNAVHYLCDEAADWYPDIDDIRSKITSNTKAIVVINPNNP
TGALYPKEVLEELVDVARQNNLIIFADEIYDRLVMDGEKHIAIASLAPDLFCVSMNGLSK
SHRIAGFRVGWMVLSGPKYHVKDYIEGLNMLSNMRLCSNVLSQHVVQTSLGGYQSVDELL
LPGGRIYEQRNFIYKAINEIPGLSAVKPKAGLYIFPKIDREMYQVDDDEQFVLDFLKQEK
ILLVHGRGFNWKDPDHFRIVYLPRVDELAQIQEKMTRFLKQYRR
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaatttaataaatcgacaaagttagaacatgtagcttatgatatccgaggtcct
gtcttagaagaagccatgcggatgcgtgcaaatggtgagaaaatccttcgcttgaacaca
ggaaaccctgctgagtttggttttacggcaccagatgaagtgattcatgatttgattatg
aatgcacgggatagcgagggctattcagactcgaaagggattttttctgctcggaaagct
attatgcaatattgccagttaaagaatattccaaatgttgatattgacgatgtctacctt
ggaaatggagtcagcgagctgattgtcatgtctatgcaaggtttgctagacaatggtgat
gaggtgctggtacctatgccggattatcctctctggactgctgctgtgagtttagcagga
gggaatgctgttcactatctttgtgatgaagctgctgattggtacccagatattgatgac
attagatcgaaaattacttctaatacaaaagctattgtcgttatcaacccaaacaatccg
acaggagctctatatcctaaggaagttttagaagagctggttgacgttgcacggcaaaat
aatttgattatttttgcggatgagatttatgatcgtttagtaatggacggtgaaaagcat
atagctatcgcaagtttagctcctgatcttttctgtgttagtatgaacggtttgtctaaa
tcgcaccgtattgcaggctttcgtgtaggatggatggtgctatctggaccaaaatatcat
gtaaaagattacatcgaagggctaaatatgctgtcaaatatgcgtctgtgttcaaatgtc
ctatctcagcacgtggtacaaacatcgcttggcggttatcaatcagtagatgagttacta
cttcccggtggaagaatttatgagcaacggaattttatttataaagctattaatgaaatc
ccaggtctatctgcagtaaaacctaaagcagggctttacattttccctaaaattgataga
gaaatgtatcaagtagatgatgacgaacaattcgtgttggatttcttaaagcaagaaaag
attttactggtgcatggacgaggctttaattggaaagatcctgatcatttccggattgtt
tacctgcctcgtgtagatgagttagcacaaattcaagagaagatgactcgtttcttaaaa
caatatcgacgatga

DBGET integrated database retrieval system