KEGG   Sulfolobus islandicus M.16.4: M164_1953Help
Entry
M164_1953         CDS       T00906                                 

Definition
(GenBank) DNA ligase I, ATP-dependent Dnl1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
sid  Sulfolobus islandicus M.16.4
Pathway
sid03030  DNA replication
sid03410  Base excision repair
sid03420  Nucleotide excision repair
sid03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:sid00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    M164_1953
   03410 Base excision repair
    M164_1953
   03420 Nucleotide excision repair
    M164_1953
   03430 Mismatch repair
    M164_1953
Enzymes [BR:sid01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     M164_1953
    6.5.1.6  DNA ligase (ATP or NAD+)
     M164_1953
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     M164_1953
DNA replication proteins [BR:sid03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    M164_1953
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     M164_1953
DNA repair and recombination proteins [BR:sid03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     M164_1953
   NER (nucleotide excision repair)
    Other NER factors
     M164_1953
   MMR (mismatch exicision repair)
    Other MMR factors
     M164_1953
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: ACR42556
JGI: SislK31953
UniProt: C4KIZ2
LinkDB All DBs
Position
1788400..1790205
Genome map
AA seq 601 aa AA seqDB search
MEFKVIAEYFDKLEKISSRLQLTALLADLLSKSDKAIIDKVVYIIQGKLWPDFLGYPELG
IGEKFLIKAISIATNTDENSVENLYKSIGDLGEVARRLKSKQQSTGILGFLGTSSKESLK
VDEVYSTLSKVALTTGEGSRDLKIRLLAGLLKKADPLEAKFLVRFVEGRLRVGIGDATVL
DAMAIAFGGGQSASEIVERAYNLRADLGNIAKIIVEKGIEALKTLKPEVGIPIRPMLAER
LSNPEEILKKVGGSALVDYKYDGERAQIHKKDDKIFIFSRRLENITSQYPDVVEYISKYT
EGKEFIIEGEIVAVDPESGEMRSFQELMHRKRKSDIYEAIKEYPVNVFLFDLMYYEDVDY
TTKPLEVRRKLLESIVKPNDYVKIAHHIQVNNVEDLKSFFYRAISEGGEGVMVKAIGKDA
IYQAGARGWLWIKLKRDYQSEMADTVDLVVVGGFYGKGKRGGKISSLLMAAYNPKTDTFE
SVCKVASGFSDEQLDELQKKLMEIKRDIKHPRVNSKMEPDIWVEPVYVAEIIGAEITISP
LHTCCQDVVEKDAGLSIRFPRFIRWRDDKSPEDATTTDEILEMYNKQPKKKIESPPIDES
V
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atggagtttaaagttattgccgaatactttgataaattagagaagatatcttcaaggctc
cagcttacagctttattggctgatcttttaagcaaaagtgataaggcaattatagataag
gtagtttatattatacaaggcaaattatggcctgattttctaggttatccagagcttgga
attggagagaaattcttaataaaagcaattagtatagctacgaacacagatgaaaattca
gtagaaaatctctataagtcaataggtgatcttggagaagtagctcgaaggttgaaaagt
aagcagcaaagtacaggaattttaggttttttgggtacttcaagtaaagagagcttaaaa
gtggatgaagtttactctacgttatctaaggtggcattaactacgggagagggtagtaga
gatttaaagataagattactggcaggattgttaaaaaaggcagatccgttagaggccaag
ttcctagttaggtttgttgaaggtcgacttagagttggtataggagatgctacagtttta
gatgctatggcaatagcttttggcggggggcaatcagcatcagaaatagttgaaagagct
tataatcttagggcggatctaggaaacattgcaaaaattatagtagagaagggaattgaa
gccttaaagactctaaaacctgaagttggaataccaattagaccgatgctagctgaaagg
ttatcaaatcctgaagaaatattaaagaaagtaggtggaagtgcattagtcgattataaa
tacgatggagagagagcccaaatacataaaaaagatgacaaaatttttatattttctcga
agattagagaacattacttctcagtatccagatgtagtagagtatattagtaaatacact
gaaggcaaagagttcattatagaaggagaaatagtggctgtagatccagaaagcggtgag
atgagatcatttcaagaattaatgcacagaaagaggaagtcagatatttacgaagcaatt
aaagagtacccagtaaacgtatttctctttgatttaatgtattatgaagatgtagattat
actacaaagccattagaagttaggagaaaattgttagaaagtattgtaaaaccaaacgac
tatgtaaaaatagctcatcatattcaagttaataatgtagaggatcttaaatcgttcttc
tatcgagcaatatctgagggtggagagggagtaatggtgaaggcaattggaaaagatgca
atatatcaagccggtgctaggggttggttatggataaagcttaaacgtgattatcaaagc
gagatggctgatacagtagacttagtagttgttggtggtttctatgggaagggtaaaaga
ggcggcaagataagctcactattaatggccgcatataatcctaagactgatactttcgaa
tctgtttgcaaggtggctagtggcttctcagatgagcaacttgatgagttacagaagaag
ttaatggaaataaagagggatataaaacatcctagagttaattctaagatggaaccagat
atatgggtagagccagtttatgtagcggaaataattggagcggagataacaatatctcct
ttacatacttgttgtcaagacgtcgtagagaaggatgctggtttatctataagatttcct
cgatttataagatggagagatgataaaagtccagaagatgctacaaccactgatgagata
cttgaaatgtacaacaagcagcctaagaagaagatcgaatcaccacctatagacgagagc
gtttaa

DBGET integrated database retrieval system