KEGG   Streptococcus intermedius JTH08: SCIM_1292Help
Entry
SCIM_1292         CDS       T02156                                 

Gene name
alr
Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
sie  Streptococcus intermedius JTH08
Pathway
sie00473  D-Alanine metabolism
sie01100  Metabolic pathways
sie01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sie00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    SCIM_1292 (alr)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    SCIM_1292 (alr)
Enzymes [BR:sie01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     SCIM_1292 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:sie01011]
 Precursor biosynthesis
  Racemase
   SCIM_1292 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C TIG DUF3847
Motif
Other DBs
NCBI-ProteinID: BAM23946
LinkDB All DBs
Position
complement(1472111..1473217)
Genome map
AA seq 368 aa AA seqDB search
MKTSNHRPTKAIVDLAAIHFNIKQIAAHIPGDVEKWAVVKADAYGHGAVAVTQSIEPIVD
GFCVSNIDEALELREAGISKKILVLGVSTIQSVPLAMKYKITYTVASLEWIDLLLQSNID
VTGLVVHIKIDSGMGRIGFRNSQDAQEAIHRLKKVGAQVEGIFTHFATADEADTQKFAAQ
LARFKEILERLDIVPPIVHASNSATTLWHADTVMKAVRLGDIIYGLNPSGRTLELPYEMK
PALSLISELVHVKQLEAGADIGYGATYTSDSPQFIGTIPLGYADGWTRDMQGFNVLIDGK
ACPVVGRVSMDQITVRLPRFYPIGTSVVFIGKSGEEVISATDVAEKRGTINYEVVCLLSD
RVPRIYKK
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgagtaatcatcgacctactaaggcaattgtggatttagcggctatccatttt
aatataaaacaaattgcggcacatataccaggtgatgttgaaaaatgggccgttgttaaa
gcagatgcctatggtcacggtgcagttgctgttacgcaatctatcgagccaattgtggat
ggtttttgtgtttccaatattgatgaagccttggaactgagagaagctggtatttcaaaa
aaaattctggttctgggagtatcaactatccagtctgttccattggcaatgaaatacaag
attacttatacggttgctagtttagaatggattgatttgttgttacaatcaaatatagat
gtaactggattggttgttcatataaaaatcgactctggaatgggtcggattggttttcgg
aatagccaagacgctcaagaagcgattcaccgtttgaaaaaagtaggggctcaggtcgaa
ggaatttttacccattttgcgacagctgatgaggcagatacgcaaaaatttgcggcacag
ttagcacgttttaaagaaattctagagcgattagatattgttcccccgattgttcatgct
agcaattctgcgacgactctttggcatgcagatactgttatgaaagcagttcgtttgggt
gatataatctatggcctcaatcccagcggccgtaccttggagcttccttatgaaatgaaa
ccggctctttctctaatttcagaactggttcatgtgaagcaattagaagcaggggcagat
attggttacggagccacttacactagcgatagcccacagttcattgggacgattccacta
ggctatgctgacggttggacgcgagatatgcaaggttttaatgttctaattgatgggaaa
gcttgtcctgtcgttggacgtgtgtctatggatcagattaccgttcgtttgcctcgattt
tatcctattggtacgtcagttgttttcatcggaaaaagcggggaagaggttatttctgca
acagatgtggcagaaaaacgtggaacgattaattatgaagtggtctgtttgcttagtgac
cgtgtacctagaatctataaaaagtga

DBGET integrated database retrieval system