KEGG   Streptococcus sp. I-G2: N596_00730Help
Entry
N596_00730        CDS       T02879                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
sig  Streptococcus sp. I-G2
Pathway
sig00473  D-Alanine metabolism
sig00550  Peptidoglycan biosynthesis
sig01100  Metabolic pathways
sig01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sig00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    N596_00730
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    N596_00730
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    N596_00730
Enzymes [BR:sig01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     N596_00730
Peptidoglycan biosynthesis and degradation proteins [BR:sig01011]
 Precursor biosynthesis
  Amino acid ligase
   N596_00730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 Ham1p_like
Motif
Other DBs
NCBI-GeneID: 17315382
NCBI-ProteinID: AGY39358
UniProt: U5P6P5
LinkDB All DBs
Position
116127..117173
Genome map
AA seq 348 aa AA seqDB search
MAKEKIVLLYGGRSAEREVSVLSAESVMRAINYDMYSVETYFITQAGDFIKTQTFEEKPA
ETERLMTNETIDWDAKVSPSSISQEGAVVFPVLHGPMGEDGSVQGFLEVLKLPYVGCDIL
SSSVAMDKITTKRVLESAGIPQVPYVAVLEGDELEAKIALIEKELTYPVFTKPSNMGSSV
GISKAENQAELRKSLELAFKYDSRVLVEQGVVAREIEVGLLGNYDVKSTLPGEVVKDVAF
YDYEAKYIDNKITMAIPAEIPAEVAATMRQNAELAFRAIGGKGLSRCDFFYTEDGGIYLN
ELNTMPGFTQWSMYPLLWDNMGLAYPDLIERLVELAKETFEKREAHLL
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagaaaaaattgtacttctttatggtggccgtagcgcagagcgcgaagtgtct
gtgctttccgctgaaagcgtcatgcgggcgattaattatgacatgtattctgttgagacc
tatttcattactcaagctggagacttcatcaagactcaaacttttgaagagaaacctgct
gaaacagaacgcttgatgaccaatgaaaccattgattgggacgctaaagtatctccgagc
agtatctcccaagaaggagcggttgtctttccagtccttcacggaccgatgggagaagat
ggatcggttcaaggtttcctagaagtattgaaactcccttatgtgggctgtgatatcctt
tcttctagtgtggcgatggacaagattaccaccaaacgggtcctagaatctgcagggatt
ccacaagttccttatgtggctgtccttgaaggagatgagctagaagctaagattgcctta
atcgaaaaggaattgacctatccggtctttaccaagccttctaatatgggctctagtgtc
gggatttcaaaagcagagaaccaagcagaacttcgcaagtctttggaattggcctttaaa
tatgatagccgtgttttggttgagcaaggtgtcgtagcgcgcgaaatcgaagtaggattg
ttaggcaactacgatgtcaagagcaccctacctggtgaagtggtcaaagatgtagccttt
tatgactacgaagccaaatacatcgataataagattacgatggcgattccagctgaaatt
cctgcagaagttgctgcgaccatgcgtcagaatgcagaactagccttccgtgccattggt
ggcaaaggtctctcccgttgtgatttcttctacacagaggacgggggcatctacttgaat
gagctcaataccatgcctggctttacccaatggtctatgtatcctttactttgggataac
atgggcttggcctatcctgatttaatcgagcgcttggtagaattagccaaagaaaccttt
gaaaagcgcgaagcgcacttactttaa

DBGET integrated database retrieval system