KEGG   Streptococcus sp. I-G2: N596_02430Help
Entry
N596_02430        CDS       T02879                                 

Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sig  Streptococcus sp. I-G2
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sig00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    N596_02430
   00020 Citrate cycle (TCA cycle)
    N596_02430
   00620 Pyruvate metabolism
    N596_02430
Enzymes [BR:sig01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     N596_02430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
467599..468642
Genome map
AA seq 347 aa AA seqDB search
MADDKLRATPAARKLADDLGINLYDVSGSGANGRVHKEDVETYKDTNVVRISPLAKRIAL
EHNIAWQEIQGTGHRGKIMKKDVLAFLPENIEKDTIKSPAQIEKVEEVPDNVTPYGEIER
IPMTPMRKVIAQRMVESYLTAPTFTLNYDVDMSQMLALRKKVLDPIMEATGKKVTVTDLL
SLAVVKTLMKHPYINASLTEDGKTIITHNYVNLAMAVGMDNGLMTPVVYNAEKMTLSELV
VAFKDVIGRTLDGKLAPSELQNSTFTISNLGMFGVQSFGPIINQPNSAILGVSATVEKPV
VVNGEIVIRPIMSLGLTIDHRVVDGMAGAKFMKDLKALIEDPISMLV
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atggctgacgataagctaagagcgactcctgcggctagaaaattagcggatgatctaggg
atcaacctctatgatgtttctggttcaggcgcaaacggtcgtgtccacaaagaagacgtg
gaaacatataaagacacaaatgtggttcgcatttcaccacttgcaaaacgaattgcttta
gaacacaatattgcttggcaagaaattcaaggaactggtcatcgtggtaagatcatgaag
aaggatgttcttgctttccttcctgagaatattgagaaggataccattaagtcgcctgct
caaattgagaaggtggaagaagttcctgataatgttacaccttatggtgagatcgagcgc
attccgatgacaccaatgcgtaaggtgattgcgcaacggatggtggaatcttacttgaca
gcaccaacctttacattgaactatgacgtcgatatgtctcaaatgttggcgcttcgtaag
aaggtattggatccaatcatggaagcaactggtaagaaagtcactgtaacagatttgctt
tctcttgcagttgttaagaccttgatgaaacacccatacatcaatgcgtcattgacggag
gatggcaaaaccatcatcactcacaactatgtcaacttggctatggcggttgggatggac
aatggcttgatgacaccggttgtctataacgcagaaaagatgactttgtcagaattggtg
gtagcctttaaggatgttatcggacgtactttggacggtaagttagctccaagtgaattg
caaaattcaacctttaccatcagtaacttgggaatgtttggtgttcaatcatttggaccg
attatcaaccaaccaaactcagccatccttggggttagcgcaactgttgaaaaaccagtt
gttgtgaatggtgaaatcgtcattcgtccaatcatgagcttgggattgaccattgaccac
cgcgttgtcgatggtatggctggtgccaaattcatgaaagacttgaaagccttgattgaa
gacccgatttcaatgttggtctaa

DBGET integrated database retrieval system