KEGG   Sesamum indicum (sesame): 105158616Help
Entry
105158616         CDS       T04135                                 

Definition
(RefSeq) histone-lysine N-methyltransferase family member SUVH9
  KO
K11420  euchromatic histone-lysine N-methyltransferase [EC:2.1.1.43]
Organism
sind  Sesamum indicum (sesame)
Pathway
sind00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:sind00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    105158616
Enzymes [BR:sind01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     105158616
Chromosome and associated proteins [BR:sind03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     105158616
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SAD_SRA Pre-SET SET TonB_N
Motif
Other DBs
NCBI-GeneID: 105158616
NCBI-ProteinID: XP_011073728
LinkDB All DBs
Position
LG3
AA seq 657 aa AA seqDB search
MGSNSVVPFQDLNLYPEPPTGPAPAPVIIPKIEPKSEPLDEPLPTPQSLHFSTPSPAPAT
APACSPSSSEADVYSEYYRISEMFRSAFAQRLQKHGDVAILPDSDLNSRAIVPVPNPETQ
VSDIVITPRSGRKYLTRSSELVRVTDLKPDDQRYFRDLIRKTRMLFDSLRVFATAEDEKR
KDLMVSHRKTRGDLKASAFMRHSGLWLNRDKRIVGDIPGVSIGDVFFFRMELCVVGLHGQ
PQAGIDYVPASQSSNGEPIATSIIVSGGYEDDEDAGDVIVYTGHGGQDKHNKQVVHQKLE
CGNLALERSMNYGVEVRVIRGFKYDGSISGKVYVYDGLYRIIETWFDVGKSGFGVFKFKL
VRIENQVEMGSSVMRFAQSLRIKPLEVRPKGYVTLDLSRKKENFPVFFYNDIDGDHDPIF
YEYLMTTVFPPYVYNSGSNNGCECIGGCLDDCFCAMKNGGEFAYDMNGILVRGKPLIFEC
GPHCRCPPMCRNRVTQKGVRNRFEVFRSRETGWGVRSLDLIQAGSFICEYAGVVLTREQA
QIFTMNGDSLIYPSRFAQRWKEWGDLSQIFSDYVCPAYPSIPPLDYAMDVSRMRNLACYM
SHSSSPNVFVQLVLYDHNNVCFPHLMLFAMENIPPLRELSLDYGVADEWTGKLAICS
NT seq 1974 nt NT seq  +upstreamnt  +downstreamnt
atgggttctaattctgtggtaccatttcaagacctgaacctatatcccgaaccccccacc
ggcccggcacccgcccccgttatcatccccaaaattgaaccaaaatctgaacccttagat
gaaccactaccaaccccacaatcactccatttctccaccccctccccggcccccgccacc
gcccctgcttgcagcccttcttcctcggaggctgacgtatactctgaatactatcgcatt
tccgagatgtttcgctccgccttcgctcagcgcctccaaaagcacggagatgttgctatt
ctgcccgattctgacctcaattcacgcgccatagtcccagtgccgaacccagaaacccag
gtttcggacatcgtcatcacgccgcgtagcggccggaagtacctaacgcgctcttcggag
ctggttcgggtcacggatctcaaacccgacgaccagcgttacttccgggacttaattcgc
aaaacccggatgctgtttgactcgctgcgagtgtttgccaccgcggaggatgaaaagcgc
aaagatttgatggtttctcaccggaaaacgagaggcgacttgaaggcttccgcgttcatg
agacatagcggtttgtggttgaatcgtgataaaagaatcgttggagatatcccgggagtt
tcgattggggatgtgttctttttcaggatggaattatgtgttgtgggattgcacgggcag
ccccaggctgggattgattacgttccagccagccaaagctctaacggggagccgattgcc
actagcattatcgtttctggaggttatgaagatgacgaggatgccggggatgtgatagtt
tacacgggacatggtggacaggataaacacaataagcaggttgtgcatcagaaattggaa
tgtggaaatttggctcttgagaggagtatgaactatggcgttgaggtaagggtgattcgt
ggttttaaatatgatggtagtatcagtggtaaagtgtatgtttatgatggattgtataga
ataatcgagacttggttcgatgtggggaagtcaggattcggggtttttaagttcaaactt
gttaggattgagaatcaggtggaaatggggagtagtgtgatgaggtttgcacagagttta
aggataaagccgttagaagttcggcctaaaggttatgttacgcttgatttgtcaaggaaa
aaggagaactttccagtgtttttctacaatgatattgatggagatcacgatcctattttt
tatgaataccttatgacaactgtttttcctccttatgtgtataattctgggagtaacaat
ggatgtgagtgcattgggggatgtttggatgattgcttttgcgcaatgaaaaatgggggt
gaatttgcttatgacatgaatggaattcttgtgagagggaaaccattaatttttgaatgt
gggccccattgccgttgtcctcccatgtgtcgaaatcgtgtgacccaaaagggggttagg
aatcggtttgaagtgtttaggtcgagggagactggttggggagtgaggtcactggacttg
atccaggctggctcttttatttgtgaatatgctggagttgttcttacacgcgagcaagcc
cagatattcacaatgaatggtgatagtttaatttacccgagtcgttttgctcaaagatgg
aaagagtggggtgatttatctcaaatattctccgactatgtctgcccagcatatccatct
atccctcctttggattatgccatggatgtatcaagaatgaggaatctagcttgctacatg
agccacagttcaagcccaaatgtttttgtgcagcttgtgttgtatgatcacaataatgta
tgttttccacatctcatgctgtttgctatggagaacatccctcccttgagagagcttagc
ctagactatggggtggcggatgaatggactggaaaacttgccatctgtagttag

DBGET integrated database retrieval system