KEGG   Sesamum indicum (sesame): 105173552Help
Entry
105173552         CDS       T04135                                 

Definition
(RefSeq) hexokinase-1
  KO
K00844  
hexokinase [EC:2.7.1.1]
Organism
sind  Sesamum indicum (sesame)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sind00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    105173552
   00051 Fructose and mannose metabolism
    105173552
   00052 Galactose metabolism
    105173552
   00500 Starch and sucrose metabolism
    105173552
   00520 Amino sugar and nucleotide sugar metabolism
    105173552
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    105173552
Enzymes [BR:sind01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     105173552
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
AA seq 496 aa AA seqDB search
MGKVAVAAAVVCTAAVCAAAVVVMRRQMKSSGRWAKAEAILRELEEKCGTPTAKLRQVAD
AMTVEMHAGLASEGGSKLKMLISYVDNLPTGDEKGLFYALDLGGTNFRVMRVQLGGKDGI
MKQEFEEVSIPPHLMVGSSHELFDFIAAALAKFVDTEGEDFHLLPGRQRELGFTFSFPVR
QLSLASGTLIKWTKGFLIEDAVGQDVVGELTKAMERLGLDMRVAALVNDTVGTLAGGRYN
NPDVIAAVILGTGTNAAYVERAHAIPKWQGLLPKSGEMVINMEWGNFRSSHLPLTEYDQI
LDAESLNPGEQIFEKIISGMYLGEIVRRVLCRMAEEASFFGDTIPPKLKIPFILRTPDMS
AMHHDTSPDLKVVGSKLKDILEVPNSSLKMRKIIVEICDIVATRGARLSAAGILGILKKL
GRDTVKEGEKQRSVIALDGGLFEHYTKFRKCMESTLKELLGDVAEDIVVEHSNDGSGIGA
ALLAASHSQYLEIDNS
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaggtggcggtggcggcggcggtggtgtgcactgcagcggtttgtgcggctgcg
gtggtggtgatgaggcggcagatgaagagctcagggaggtgggccaaggcggaggcgatt
ctgagagagttggaggagaagtgtgggacccctacggcgaagctccggcaggtggccgac
gccatgacggtggagatgcacgccggtcttgcctccgaaggtggcagtaagctgaagatg
ctcatcagctacgtggataacctccccactggggatgaaaaaggattattctatgcattg
gaccttggtggaacaaacttccgtgttatgcgggttcagttaggtggtaaagacggtatt
atgaaacaagaatttgaagaagtctcgattcctccacatttgatggttggatcatcacat
gaattatttgactttattgctgctgcccttgcaaaatttgttgatacggaaggtgaagac
tttcatctcttacctggtagacaaagggagcttggtttcaccttttccttcccggttagg
caattatcattagcatcaggaaccctgataaagtggacaaaaggattcctcatagaagat
gcggttggacaagatgttgtgggagagctcacaaaagcaatggaaagactcggccttgat
atgcgtgttgccgctcttgtcaatgatacagttggaacattagctggaggacggtacaat
aatccagatgtcattgctgctgtgatcctgggaacaggaactaatgcagcatatgtcgaa
cgggctcatgcaattccgaagtggcagggtctgctacctaagtccggggaaatggttata
aacatggaatggggtaactttcgatcatcacatcttccacttacggaatatgatcaaata
cttgatgctgaaagtttaaaccctggagaacagatttttgagaagataatttctggtatg
tatctcggagaaatcgtccgtagagttttatgcaggatggccgaagaagcatcctttttt
ggtgataccatcccaccgaaactcaaaattccattcatattgaggactcctgacatgtcc
gctatgcatcacgacacctctcctgatctcaaagtggtcggaagtaaactaaaggatatt
ttggaggtacctaattcctccttgaaaatgaggaaaattatcgtggagatatgcgacatc
gttgccacacgaggggcccgtctctctgctgctgggatacttggtattctcaagaaactc
ggaagagacactgtgaaagagggagagaagcagaggtcagtcatcgctttggacggtgga
ttgtttgagcactatactaagttcagaaaatgtatggagagcactcttaaggagctgctg
ggagatgttgcagaggatatcgtcgtcgagcattcaaatgacggctcgggcattggagct
gctcttctagcagcttctcattcccagtacctggaaatcgacaactcctga

DBGET integrated database retrieval system