KEGG   Sesamum indicum (sesame): 105175982Help
Entry
105175982         CDS       T04135                                 

Definition
(RefSeq) probable glutathione S-transferase isoform X2
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
sind  Sesamum indicum (sesame)
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:sind00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    105175982
Enzymes [BR:sind01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     105175982
Transporters [BR:sind02000]
 Other Transporters
  Pores ion channels [TC:1]
   105175982
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
AA seq 220 aa AA seqDB search
MSKDELVLLDFGLSPFCMRVKIALAEKGLQYEGQEEDLFGGKSELLQKSNPIYEKVPVLL
HNGKPILESTNIVYYIDETFASPPLLPACSYGRSRARFWADFIDKKVFDAGAAIWRSKGD
ELELAKKEFIDILKKLEGAMGDKDYLGGDTFGFVDIVLIGLSSWFPAYEKFGGFKIEDEC
PKIGAWIKRCKGRESVAKTLPDPQQVCELVGMLRKMHGIE
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaagacgagctggtgttgctggatttcgggttgagtccgttttgcatgagagtg
aaaattgcattggcagagaaagggctgcagtacgagggacaggaggaggacctgttcgga
gggaaaagtgagctgctgcagaaatccaaccccatctatgagaaggtccctgtgcttctg
cacaacggcaagcctattcttgagtccactaacattgtgtattacattgatgagactttt
gcttccccgcccttgctgcctgcttgttcttacggacggtcccgggcacgcttctgggcc
gacttcatcgacaaaaaggtgtttgatgccggagccgcaatatggaggagcaaaggcgac
gagcttgaattagctaaaaaagagttcatcgatattctgaagaagctggagggtgcaatg
ggcgataaggactacttgggaggtgacacgtttgggtttgttgacattgtactcatcgga
ttatcgtcatggtttccggcctacgagaagttcgggggtttcaagattgaggacgagtgt
cctaaaattggagcttggatcaagaggtgcaaggggagggaaagtgtggccaaaactctg
cctgatcctcagcaagtgtgtgagcttgtgggaatgctcagaaagatgcatggaattgaa
tga

DBGET integrated database retrieval system