KEGG   Sesamum indicum (sesame): 105177720Help
Entry
105177720         CDS       T04135                                 

Definition
(RefSeq) histone-lysine N-methyltransferase SUVR5
Organism
sind  Sesamum indicum (sesame)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
AA seq 1489 aa AA seqDB search
MEVLACSGARHARESDCPEQGSETAFKHDEKSDCVQDAEQVRTDLKVDDLTLDIGESHEV
REEGGQFICDGFPASEGGSNGDTYYEFDVDGQNLSCYSHDSEDDNLDKRDHFAEAGLALE
GSHLVLGTIESGLPNNSQEGSSHSEIKGLERDEPQAVWVKWRGKWQSGIRCARADWPLPT
LKAKPTHDRKQYLVIFFPRTRNYSWADVLLVRPINEFPQPIAYKTHKVGVKMVKDLTLAR
RFIIQKLAVSMLNILDQLNREALVETAREVMVLKDFAMEASRCKDYSDLGRMLLKLQDMI
LQRCLTSDWLHQSMHSWKQRCQDANSAECIEMLKEELADSILWNEVSLLSSEAAQADLGS
DWKSWKHEVMKWFSVSHPISTAVGSDQPMNDSPLTMGLQMTRKRPKLEIRRADTHASSSH
QSVPVETDSTFFNGYDVVNTALLDSETLKKESPVEDAVPVGSSGCVANKWNDIVVEAGNL
EVMKSKDVDQTPASDITQKSSGLENHNRQCMAFIEAKGRQCVRYANEGDVYCCVHLASRF
VGNSAKAEMAPVDSPMCGGTTVLGTKCKHRALIGFSFCKKHRPQDGRKMIAPVNKLKRKH
DENSMYSEKTPAKFVLTREDEIPACVDPLLDVGKGIIQDSSMNDKPEQPQQALGSNDMVQ
CVGSWPQGGEEPCLESPKRHSLYCEKHIPSWLKRARNGKSRIVSKEVFVELLKSCEIREQ
KLQLHHACELFYRLFKSILSLRNPVPKEVQFQWAIAEASKDIKVGEFLMKLVCSEKERLK
KLWGFGDGQNLQASSTIEELIPVLVQTSNDSDQENVIKCKICSEKFLDDQALGTHWMDSH
KKEAQWLFRGYVCAICLDSFTNKKVLEAHVQERHHVQFVEQCMLLQCIPCGSHFGNPDEL
WLHVLSIHPSSLRLSSAAQQLDGSSQQKVEPDKSASIEHTKSDSQSVNRRYICRFCGLKF
DLLPDLGRHHQAAHMGQNSTGPRLTKKGIQFYAHKLKSGRLTRPRFKKGLNSASYKIRNR
SVQNLKKRIQASNSIGPVDIMVQSAVPEADSLGRLADSQCSAIANILMSEIKKTKPRPSN
SEILSIASSACCKASLQASLEVKYGILPERVYLKAAKLCSEHNISVEWHQEGFICPKGCT
PSVRSPILSLLVPLPNYSFKVRSSVPSHLMNSEWTMDECHCVIDSRHFSMDLSEKNIILC
DDISFGQESVPIACVVDENXXXXXXEYSFPWESFTYITKPLLDQSLVLESESLQLGCACA
HLTCCSEACDHVYLFDNDYEDAKDIYGKPMNGRFPYDERGRIVLEEGYLVYECNQRCCCS
RACRNRVLQNGVQVKLEIFKTERKGWAVRARETILRGTFVCEYIGEVIDEKEANERRNRY
GKEGCRYFYEIDAHINDMSRLIEGQVPYVIDATNYGNISRYINHSCSPNLVNHQVLVESM
DSQLAHIGFYASRDIALGEELTYDFRYKLLPGEGCQCLCGAPSCKGRLY
NT seq 4470 nt NT seq  +upstreamnt  +downstreamnt
atggaagtccttgcatgttctggtgctcgtcatgctcgcgaatctgattgtcctgaacag
ggatcagaaacagcttttaaacacgatgaaaaatctgattgcgttcaagatgctgaacaa
gttaggactgatctcaaagttgacgacttgacacttgatattggagagtctcatgaagta
agagaggagggaggtcaatttatttgtgatggtttccctgcttcagaaggcggctctaat
ggggatacatactatgaatttgatgttgatggtcaaaatctgtcttgttactcccatgat
tctgaagatgacaacttagacaaaagggatcattttgcagaagctggtcttgcattagaa
ggttctcacttagtcttgggtacaattgaaagtggactgccaaacaacagccaagagggt
tcatcccattccgagatcaaaggcctagaaagagatgagcctcaagcagtttgggtaaag
tggagagggaagtggcaatcagggatcagatgtgcaagggctgactggccattaccaact
ttaaaagcaaagccaactcatgacaggaaacaatatcttgtgatattttttccccgaacg
agaaattattcttgggcagatgtgctactagttcgtccaatcaatgaatttccgcagcct
attgcatataagacgcacaaagttggtgtgaagatggtgaaagatttgactcttgctcgt
cgctttatcattcagaagcttgctgtgagcatgctaaatattcttgatcaattgaaccgc
gaggctttggtggagactgctcgtgaagtgatggttttgaaggattttgcaatggaggct
tcccgctgtaaagattattctgatcttgggaggatgcttttgaaacttcaagatatgatt
ctgcagcgctgcctaacttcagattggcttcaccagtcaatgcattcttggaagcaacga
tgtcaggatgccaatagtgctgaatgcatagaaatgcttaaagaggaattggctgactct
atcttatggaatgaggtaagcttactatcgagtgaagcagcacaggcggacctaggatct
gattggaagagttggaaacatgaggttatgaaatggttctcagtttctcatccaatatcc
actgctgtaggctcggaccagcctatgaatgatagcccattgaccatgggacttcagatg
accaggaaaaggcctaagcttgagattcgccgtgctgatacgcatgcctctagttcgcat
cagtctgttcctgttgaaactgactcaacattttttaatggatatgatgttgtaaacact
gcattgctggattctgaaactctgaaaaaagagagtcccgttgaggatgctgtcccagtg
ggatcttctggttgtgtagctaataaatggaatgatatagtcgttgaggctggaaatttg
gaggttatgaagagtaaagatgtggaccagactcctgcgagcgatattactcagaagtct
tcaggattggaaaatcataatcgacaatgcatggcttttattgaagctaaaggaaggcag
tgtgtgagatatgctaatgaaggagatgtctactgctgtgtgcatttggcctctcgtttc
gttggaaattctgcaaaagctgaaatggctcctgttgactcaccaatgtgtggaggtacc
acggttcttggcactaaatgcaagcatagagccttaattgggttttctttctgcaagaag
cacaggccccaagatggaagaaaaatgattgctcctgttaataaacttaaacggaaacat
gatgaaaatagtatgtattcggagaaaactcctgcaaaatttgtactcactagagaagat
gaaattcctgcctgtgtagatccactgttggatgtgggaaaaggtatcatacaagatagc
agcatgaatgataagcctgagcagcctcagcaagctctcggcagcaatgacatggtgcag
tgcgtaggttcatggccccagggtggtgaagaaccctgtcttgagagtccaaagaggcat
tcactgtactgcgagaaacatataccaagctggcttaaacgtgcaagaaatggcaagagt
aggatagtgtccaaggaagtgttcgtagagcttcttaaaagttgcgagataagggagcaa
aaattgcagttacaccacgcatgtgaactcttttacaggctgttcaaaagcatattatct
ttgagaaacccagtacctaaggaagtacaatttcagtgggccattgctgaagcttccaaa
gatattaaagtaggggaatttttaatgaaattagtatgtagtgaaaaagagaggctgaag
aagctctggggctttggagatggtcaaaacttgcaagcttcatcaacaattgaagaatta
attccggtattggtacagacatctaatgacagtgatcaagaaaatgtcatcaagtgcaaa
atatgttcagaaaagtttcttgatgaccaagcacttggaacacactggatggatagccat
aagaaagaagctcaatggctatttaggggctatgtctgtgcaatctgcctggactctttt
actaataagaaggtattggaagctcatgtgcaggagaggcaccatgtgcagtttgttgag
caatgcatgcttttacagtgtattccttgtggcagtcattttgggaatccagatgagttg
tggttgcatgtgctctcaattcatccttccagtttaaggttgtcaagtgctgctcaacag
ttagatggaagttcacagcagaaagtagagccagataagtcagcttctatagagcataca
aaatctgacagtcagtcagttaataggagatatatttgcaggttttgtggcttaaaattt
gatttgctacctgatcttggccgtcatcatcaagctgctcatatgggccaaaattccact
ggtcctcgcctgactaagaagggaattcaattttatgcccataagctgaaatcaggtaga
ctaactcgtccacggtttaaaaagggtttgaattcagcatcatataagattaggaataga
agtgtgcaaaatttgaagaaacggatccaggcgtcaaattctattggaccagtggatatc
atggttcaatcagctgtgcctgaggctgatagtcttggtagattggcagactctcaatgc
tcagctattgcaaatatattgatgtcagaaattaaaaaaacaaaaccaaggccaagtaat
tccgaaattttatcaattgcgagctcagcttgctgtaaggcaagtctacaagcctcattg
gaggttaagtacggaatccttccagaaagggtgtacctcaaagctgccaaactatgcagt
gagcataatatttcagttgaatggcaccaagagggttttatttgtcctaaagggtgcaca
ccaagtgtaaggtcaccaattttgtctctgctagtacccttaccgaattattcgtttaag
gtcagatcttcggttccatcacatctcatgaactcagaatggacaatggacgaatgtcac
tgtgttattgattcccgacacttttccatggatctctcggagaaaaatattattttatgt
gatgacataagttttggacaggagtcggtgcccatagcttgtgtggtggatgaaaatcnn
nnnnnnnnnnnnnttgagtactcctttccatgggaaagctttacttacattacaaagcca
ttgcttgatcaatcccttgttcttgaatcagagagtttgcaattggggtgtgcttgtgcc
catttgacgtgctgttctgaagcatgtgatcatgtgtatctttttgacaatgattacgaa
gatgctaaagatatttatggaaagcccatgaatggaaggtttccctatgatgagagaggt
cgaatagtattggaggaaggttatctagtttacgagtgtaatcagaggtgctgctgcagt
agagcttgtcgaaacagggttttgcaaaatggagtgcaagtgaagttagaaatatttaaa
acagaaagaaagggatgggcagtgagggctagggaaacaattcttcgtggcacctttgtg
tgcgagtatattggagaggtcattgatgaaaaggaagcaaatgagagacgcaataggtat
ggtaaagaaggttgcagatatttttatgagattgacgcccatatcaatgacatgagcaga
ttgattgaagggcaggttccatatgtaattgatgccaccaattacggaaacatttcacgt
tacattaaccacagctgctcgccaaaccttgtgaatcatcaagttctggtcgaaagcatg
gatagtcaacttgcacacattggcttctatgccagccgcgatatagctttgggggaagaa
ttgacatatgatttccggtacaagctattgcctggagaaggatgccaatgtttatgtgga
gctcccagttgcaaggggaggctttattag

DBGET integrated database retrieval system