KEGG   Sinorhizobium sp. CCBAU 05631: SS05631_b61200Help
Entry
SS05631_b61200    CDS       T05069                                 

Definition
(GenBank) ATP-dependent DNA ligase clustered with Ku protein, LigD
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
sino  Sinorhizobium sp. CCBAU 05631
Pathway
sino03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:sino00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    SS05631_b61200
Enzymes [BR:sino01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     SS05631_b61200
DNA repair and recombination proteins [BR:sino03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     SS05631_b61200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_C DNA_ligase_A_M RNA_ligase
Motif
Other DBs
NCBI-ProteinID: ASY60212
UniProt: A0A249P3B7
LinkDB All DBs
Position
pSS05631b:1162537..1165089
Genome map
AA seq 850 aa AA seqDB search
MGLETYREKRDFASTPEPKGGKARRSGNSFVVQKHDATRLHYDFRLEMDGVLKSWAVTKG
PSPVPGEKRLAVHVEDHPLEYGDFEGTIPKGEYGGGTVILWDRGTWTPIGDARRGYAKGH
LDFELSGEKLGGRWHLVRMAGKPREKRENWLLIKGDDEAARSEQDPDILEERPESVLTGR
EIKDVAGEEPGWSSKTGRIRKRARGRKTAASPGQEPEAASNVPDPAKFKGAKRAPLPDFV
EPSLATLVASAPAGERWLHEIKFDGYRLQARIEAGRTKLLTRGGLDWTKRFGKALVSALQ
ALPVGTALIDGEVVVETGSGASDFSGLQADLSEGRSDRFRFYVFDLLYLDGYDLRALPLV
KRKELLGQLISEGDGLIRFSSHFEEEGSLVLRHACRLSLEGIVSKQRDAPYRAGRNKSWV
KSKCSARQEFVVAGYVPSTTSRKAIGSLVLGVYQGGKLHHVGRVGTGFTVAVAEELFKRL
DRLRTPESPFAARLAAEDARQVRYVRPELVAEVEFRAWTADGLLRHASFRGLREDKPARD
IVRETPKSAAVAPKAPRRTVKLTHPDRFYWPDEGVTKEGLADYYSEVWRFVGPHIVGRPL
ALVRCPNGITGETFFQKHAWKGLNPNIVLVNDPKDPPDEQLLSIRDLDGLMGLVQSAVLE
IHPWGSTVADWERPDTIIMDLDPGEDVPFEAVIEAALETAGRLKAAGLVPFVKTSGGKGL
HVVAPLKPKAEWPAVKAFTKLVADAMASDSPDRFVSTISKSKRRGKILVDYLRNQRGATA
VAPYSTRARPGAAVSMPLSWDELAPSIGPAYFTVENTPTRLASLHADPWADFRAAAVPLK
EAKAGRRRAA
NT seq 2553 nt NT seq  +upstreamnt  +downstreamnt
atgggcctcgaaacctatcgggaaaagcgcgacttcgcctcgacacccgaaccgaagggg
ggcaaagcgcgtcgatccggcaacagtttcgttgtccagaagcacgacgccacgcggctg
cattacgacttccggctggagatggacggggttttgaagagctgggccgtcactaagggt
ccgagccccgttcccggcgagaagcgccttgccgttcacgtcgaggaccaccctctcgaa
tacggagatttcgaaggcacgatcccgaaaggcgaatatggcggcggtaccgtcatcctg
tgggatcgcggcacgtggacgccgatcggcgatgcccggcggggctacgcgaaaggccat
ctcgacttcgagctcagcggcgaaaagctcggcggccgctggcatctggttcggatggcc
ggcaagccgcgcgagaaacgggaaaactggctgctgatcaaaggcgacgacgaggcggcg
cgatcggagcaagaccccgatattctcgaggagcggccggagtcggttctgaccggccgc
gagatcaaggatgttgccggcgaagagccgggctggtcgtcgaagaccggccggatacgc
aagcgggctcgcggcaggaaaaccgccgcttcaccagggcaggagccggaagcggcttcg
aacgtcccagatcccgcgaagttcaagggcgccaagcgggctcctttgccggacttcgtc
gagccctcattggcgaccctcgtcgcctccgcgccggccggcgaacgctggctccacgaa
atcaagttcgatggctaccggttgcaggcgcggatcgaagccgggcgcaccaagcttctc
acccgtggcgggctggactggacgaaaaggttcggcaaggcgctggtgtcggcattgcag
gcgctaccggtcggaacggccttgatcgacggcgaggtcgttgtcgaaacgggctccggg
gcctccgacttttccggattgcaggccgacttgagcgagggtcgcagcgatcgtttccgc
ttctatgtcttcgacctgctctatctcgacggctacgacttgcgcgctctgcccctggtc
aaacgcaaggagctgctcggccagctgatcagcgaaggcgatggcctcatccgcttcagc
agccatttcgaggaggaaggcagcctggtgctgcgtcatgcctgcaggctgagcctcgaa
ggcatcgtctcgaagcagcgcgatgcgccctatcgtgcgggacggaacaaaagctgggtg
aaatccaagtgctcggcgcgtcaggagttcgtcgtcgccggctacgtgccgtcgaccacg
tcgcgcaaggcgatcggctcactcgtgctcggcgtctatcaaggcggcaagctccatcat
gtgggccgcgttggaacagggttcaccgtcgccgttgcggaggagctcttcaagaggttg
gaccgtttgcggacgcccgagagcccgttcgcggcgcggcttgcggcggaagatgcgcgc
caggtccgatatgtcaggccggagctcgttgccgaggtcgagttcagggcctggaccgcc
gacggccttctccgccacgcttcgttcaggggattgcgagaggataaacccgcccgcgac
atcgtgcgcgaaacgccgaagtccgcggcagttgcgcccaaggctccgcgtcggaccgtg
aaactcacccaccccgaccggttctactggccggacgagggtgtcaccaaagaggggctc
gccgattattactccgaagtctggcgctttgtcggcccccatatcgtcgggcgcccgctc
gctttggtcagatgccccaacgggatcaccggggagacgttcttccagaagcatgcctgg
aaggggctgaaccccaatatcgtgctcgtcaacgatccgaaggacccgcccgacgaacag
ctgttgagcatcagggatctcgatggcctgatggggctagtccagtccgcggttctcgaa
atccatccttggggctcgacggtcgccgattgggaaagaccggacacgatcataatggat
ctcgatcccggcgaggacgtgccgttcgaagcggtgatcgaagctgcgctcgagaccgca
ggccgcctgaaggcggccggccttgttcccttcgtcaagacatccggcggcaaggggctt
cacgtggtggcgccgttgaagcccaaggcggagtggccggccgtcaaggccttcaccaag
ttggttgccgatgcgatggcctccgacagtcccgaccggttcgtttcgaccatcagcaaa
tccaagcgccgcggcaagatcctggtcgactatctgagaaaccagcgcggcgcgaccgcg
gtggccccctattcgacgcgagcgcggccgggcgccgccgtctcgatgcccctctcctgg
gacgaattggctcccagcatcggaccggcctatttcacggtggagaacacgccgacgcgg
ctggcgtcgctgcacgccgacccatgggcggattttcgcgcggccgccgttccgctcaag
gaggcgaaggccgggcgaaggagggccgcgtaa

DBGET integrated database retrieval system