KEGG   Streptococcus sp. I-P16: N597_08565Help
Entry
N597_08565        CDS       T02880                                 

Definition
(GenBank) beta-galactosidase
  KO
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
sip  Streptococcus sp. I-P16
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sip00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    N597_08565
  Lipid metabolism
   00600 Sphingolipid metabolism
    N597_08565
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    N597_08565
Enzymes [BR:sip01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     N597_08565
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1743042..1749914)
Genome map
AA seq 2290 aa AA seqDB search
MGKSFFEKRSVFSIRKFAVGACSVLIGVSFFGAPSVLAEEEGRAVTEEETTATTERSEQP
NGEVGTSDKVSTTIEAPAVITPERNEREIEQPQVGPQTSERSVGATEEATKDQKQVAEDM
VQDRERDFNKDWYFKLNAAPGAEGRQVDVKNWKKLDLPHDWSIFFDFDHNSPAQNEGGQL
NGGDAWYRKTFRLDDKDLDKKVRLEFGGVYMDSKVYVNGQLVGHYPNGYNAFSYDITPYL
NADGSENTIAVHVVNQQPSSRWYSGSGIYRDVKLSVTDKVHVAKYGTTITSPKLEEQKNG
AVDTLVKSRIVNQDDQAHSIYAEYEIVDQNGQVVSEKVRSEVQSVLAGQELNLSHTLHVE
KPTLWDVKTNNPALYTLYTRVYRDSQLVDVQKERFGYRYLNWTPEGGFFLNGVATKFHGV
SLHHDHGALGAEENYKAEYRRLKQMKDMGVNAIRTTHNPASEQTLQIAAELGLMVQEEAF
DTWYGGKKQYDYGRFFEKDATHPEARKGDKWSDYDLRTMVERGKNNPSIVMWSIGNEIGE
ADGSDKSVATVRRLVKTIKEVDATRYVTMGADKFRFGDGSGGHEKVAAELDAVGFNYSEA
NYESLRAKHPNWLIYGSETSSATRTRGSYYHPEREWVGSNQEDRHYEQSDYGNDRVGWGR
TATASWTFDRDHAGYAGQFIWTGTDYIGEPTPWHNQNDTPVKSSYFGIVDTAGLPKNDFY
LYQSQWLSAEKHPMVHLLPHWNWDNPELANRVMDEEGRIPVRTFSNAHSVELIVNGESQG
VKTFTKKTTADGRTYQEGANPDELYLEWLVSYVPGKVEAIARNEAGEVIARDQIETAGKP
AGVRLLKEEHAIAADGKDLTYITYEIVDEAGRVVPTANNLVHFHLHGQGQIVGVDNGEQA
NRERYKAQEDGSWQRRAFNGKGVVIVKSTEQAGSFTLYADSDRLQSDQVSLFTGKKDQEE
RSILGVEPVRTQVYLGQNPELPSHVSVVYSDGKAQEEAVEWDAADYSRAGQVRVTGHVQG
RTVEALVDVIGVEQVLPVIKQIPQGADLATVDKAVQLVFTDGRTASYDVDQWTLEAGQEE
QLSTPGARLKATGLLSNGETVQATLVVAGGTVSKAKKPTVELDGVALPKFGSGNHTIFRP
LAYGQEPGQVTASAENAQVTVLQANRENGLKAQIFVTAKDTGAVQTYAVQFQEESPQIQR
LELRLPEGQELKEDQTVTLDVLAHYQDGSVASLQADQIDVVTAAGSQGKAVASKKGLELR
EAGLVHLQASFQGQTGELTFTITPNPEVKTVVKVRPVRISTDRNVLPALPETVLVEYDKG
FPKEKRVTWDAVTADQVKDYHSFTVTGQVEGVEKEAQAQVTVEGIIAVEEVSTTTPVGEK
PALPESVRTYHSNGKTYAAKVAWDTVDPQLLAQEGEVVVSGRVDGTNLPTRLHIRVSSNT
VKGANVAEQWTGSVLPLAFASDSNDADPVAKVNDKVISFTDAPANRWTNWGRDNAEDSVG
ILFGDSGILTKRAVDNLHVGFHEDHGVGAPSEYVIEYYAGEQIPTVPSNPNRVKDETDHP
FNNPANWKEVSNLTVQEPVAAGKMNHFSFDKVDTYAVRIRMKTPEGKRGSSISEIQVFAN
KVAAEEKSQVTIRVNGEVLPGVNPSVTDYYIDARDRAYPQVEATASHHGLATVVPSVHEG
EPIRVVHKAEDGTILQEYRLHLTSDAEKLKQSAPVAVEAGRRFVKVGQNLVLPSTVGVYF
KGDTGYDRKELTVDWQAVPADALSHEGNFTLEGKVIGYNLTAQLTVRVSEKTGEILSVNR
DYNAEDSRAFASETNDLDPNQIDYIDYINDGGYNEYYRWTNWKREPDQTEVFAGLIFKKN
GQVTERLVNKVAVDFFADQETGLPTKTVLERYIGPDFDVPDDYGNLKNLPEHPFNQASNW
EEIPYSLDYAFEPGYISNLSFNETRTKAMRLRMVRDENLKGIGIVELSAYAPTEEPNATT
DVSIQVNGKELEGFNPDVTDYHLEYEGERPIVSAQGKNGAAVTVVDAKDSNAPVLVKVVS
EDGKIEKIYQISLLAKAPIGSAIPEEGVKNLVHTKPELVIEPEEMDFERLERPNAELPKG
EKRVVQEGQKGRKLRLVEVSQENGVESRKKLDAFVELDPVAEITEVGTKEVLPDTPQPEP
QPEPQPQPEPQPQPQPEPQPQPQPEPQPRPEPQPLPNPEHPHGSEGPVATPTPQTSLEVK
AVRQEGTDAAGKEVEKTAQTPAVSATSVSEGRLPNTGTEESVASLVAGLLAAGLAGAVLD
DQKKRADKAK
NT seq 6873 nt NT seq  +upstreamnt  +downstreamnt
atgggaaagtctttttttgaaaagcgcagtgtatttagtattcgcaagtttgcggttgga
gcttgctctgtattaatcggtgtatctttttttggagctccgtctgttttagctgaagaa
gaaggaagagctgtaacggaagaggagacgacagccacaacagaaaggtcagagcaaccg
aatggagaggttgggacaagtgataaagtttcaacaaccatagaggctcctgctgtgatt
actcctgaaagaaatgagagagaaatagaacagccacaggtgggacctcaaacaagtgaa
cgttctgttggggctactgaagaggctacgaaggaccaaaaacaagtagcggaggacatg
gtgcaagatcgcgaacgagactttaacaaggactggtatttcaaattaaatgcagctcct
ggtgcagaaggtcgccaggtggatgttaaaaactggaaaaaattagatttgcctcacgat
tggtcgatcttctttgacttcgaccacaactctccggctcaaaatgaaggcggacaatta
aacggtggggatgcttggtatcgcaagaccttccgtttggacgacaaggacctcgataag
aaggtgcgcttggaatttggtggagtttacatggattccaaagtctatgtaaacgggcaa
ttggttggtcattatccaaatggttacaatgccttttcttatgatattaccccttattta
aatgcggatggaagcgaaaacaccatcgcagttcatgtggtcaaccaacaaccaagtagt
cgttggtattcaggaagtgggatctatcgggatgtcaaactcagtgtgacagacaaggtt
catgtggccaagtatgggaccacgatcactagtccaaaattagaagaacaaaagaatggg
gcagtcgatactctagtgaagagtcgtattgtcaaccaagatgatcaagcccatagtatt
tatgcggaatacgaaatcgttgatcaaaatggtcaagtggtcagtgaaaaggtgcgtagt
gaagtgcaatccgttttggctggtcaagagctcaacctgtctcatacccttcatgttgaa
aaaccgaccctctgggatgtcaaaaccaataacccagccctctatactctctatactagg
gtctatcgcgattcgcagttggtcgatgtgcaaaaggaacgttttggctaccgttatctg
aactggacgccagaaggtggcttcttcctcaatggagtggctacgaaattccacggtgtt
tcccttcaccatgaccacggtgcgctcggagccgaggaaaattacaaggctgaatatcgc
cgtctcaaacagatgaaggatatgggagtcaatgctatccggacgacccacaaccctgcg
agtgaacaaactctgcaaattgcagcggaattgggcttgatggtccaagaagaagctttt
gatacctggtatggtggcaagaaacaatacgattacggtcgtttcttcgaaaaggatgcg
acccatccagaagctcgtaaaggggataagtggtctgactatgaccttcggaccatggta
gagcggggcaagaacaatccttctattgtgatgtggtccatcggtaacgaaatcggtgaa
gcagatgggtctgataagtctgtcgcaactgtccgtcgtctcgtcaagaccatcaaggaa
gtggatgcaacccgctatgttaccatgggggctgataaattccgctttggcgatggttca
ggaggccatgaaaaggtggcagcagagctcgatgcggttggatttaactattcagaggcc
aactacgaaagcctacgagctaaacatccgaattggctcatttacggttctgaaacttct
tctgcaacgcgaacacggggctcttactatcatcctgaaagagaatgggtaggaagcaac
caagaagatcgccattatgaacaatcagactacggcaatgaccgggttggttggggtcgg
acagcgacagcctcttggacttttgaccgcgatcatgccggctatgcaggtcaatttatc
tggacaggtacagactatatcggtgagccaacaccatggcacaaccaaaatgatacacct
gtgaaaagttcttatttcggtatcgtggatactgcaggacttccaaagaatgatttttat
ctttaccaaagtcaatggttgtcagctgagaaacatccaatggtccatctcttgccacat
tggaactgggacaatccagaattggccaatcgtgtcatggatgaagaaggacggattcct
gtccgtaccttctccaatgctcatagtgtggaattgattgtcaatggggaatcacaaggg
gtgaagacctttactaagaaaaccacagctgatggccggacctatcaggaaggggcaaat
ccggatgaactctatctagagtggttggtttcttatgtaccaggtaaagtggaagccatt
gctcgcaacgaagcaggggaagtaattgcccgcgatcagatcgaaacagctgggaagcca
gcaggtgttcgtctgctaaaagaagagcacgccattgcggcagacggtaaagatttaact
tatattacctatgaaatcgttgatgaagcaggccgtgtcgtgccaactgccaataacttg
gtgcatttccatctgcatggacaaggccaaattgtcggcgtcgacaacggggaacaagcc
aaccgtgaacgctacaaagcacaggaagatggctcatggcaacgtcgggcctttaacggc
aaaggggtggtcattgtcaaatcaactgagcaagcaggatcctttactctttatgctgac
tcagaccgcttgcaatcagaccaagtcagcctctttacaggcaagaaggaccaggaagaa
cgctctatcttgggagtagaaccggttcggactcaagtgtacttgggacaaaatcctgaa
cttccaagtcacgtatctgttgtttatagtgatggcaaggcccaagaagaagccgtcgaa
tgggatgcagcagactatagtcgtgctggccaagtccgggtgacaggtcatgttcaagga
cggacggtcgaagctctggttgatgtgatcggtgtggagcaagtccttccagttatcaaa
caaatcccacagggagcggatctagcaacggtggataaggctgtgcaattggtctttaca
gatggtcgaacagctagttatgacgttgatcaatggaccttggaagccggtcaagaggag
caattgtctacaccaggtgctcgcttgaaggcgacaggactattaagtaatggggaaaca
gtccaagcgacactggtggttgcaggtggaacagtcagcaaggctaagaaaccaacagtg
gagctagatggagtagcgcttccaaaatttggtagtggtaaccatactattttccgtccg
ctagcttatggtcaagagcctggtcaggtcacagcgagtgcagaaaatgcccaagtgacg
gtcctacaagccaatcgagaaaatggtttgaaagctcaaatttttgtcactgctaaggat
acgggagctgtacagacctatgctgtgcaattccaggaagaaagtccacagatccagcgt
ttagaattgcgtctgccagaaggccaagagctcaaggaagaccaaacagtcacgcttgat
gtcctagctcattaccaagatggcagtgtggctagtctccaagcggatcaaatcgatgtg
gtaacagcagccggtagtcaaggaaaagcggtcgcaagcaagaaaggtttggaactgcgg
gaagcaggattggttcatttacaagctagcttccaaggacaaacaggagaattaaccttt
accatcacgcctaatccagaagtaaagacagttgtcaaggtacgtcctgtacggattagc
accgatcgaaacgttttgccagctcttccagagacagtgttggttgagtatgacaaggga
ttcccgaaagaaaaacgcgtgacctgggatgccgtaacagcagatcaagtcaaggattac
catagctttactgtcacaggtcaggtagagggtgtggaaaaagaagcccaagcccaagtc
acagttgaaggcattatcgctgtagaagaagtcagcaccacaactccagtcggtgaaaaa
ccagcacttccggaaagcgtgcggacttatcactccaatggtaagacctatgctgccaag
gtagcctgggatacggtagacccgcaactcttggcccaagaaggagaagttgttgtctcc
ggtcgtgtagacggaaccaatcttccaacccgtctccatattcgtgtttcctcaaacaca
gtcaaaggggctaatgtagcagaacaatggacaggttccgtcttgccactcgcttttgca
agtgattctaacgatgcggatccagttgctaaggtcaatgacaaggtcatctcctttacc
gatgctccagccaaccgttggaccaactggggccgtgacaatgcggaagattctgttggt
atcttgtttggggactctggtatcttgaccaagcgtgcagtggataacctccatgttggt
ttccacgaagaccacggcgttggggctcctagtgaatatgtgatcgagtactatgcgggt
gagcaaatcccaacagtaccaagcaatccaaatcgcgtcaaagacgaaacagatcatcca
tttaacaacccagctaactggaaagaagtcagcaacctcaccgttcaagaaccggtagca
gctggcaagatgaatcattttagttttgataaagtcgacacttatgcagttcggatccgc
atgaagacaccagaaggcaaacgtggaagctctatttcagagattcaagtatttgccaat
aaggttgcggcagaagaaaagagccaagtgaccattcgtgtcaatggtgaggttttgcca
ggggtcaatccaagtgtgacagattactacatcgatgcgcgtgatcgggcttatcctcag
gtggaagcgacagctagccatcacggccttgcaacggttgtgccaagcgtccatgaaggt
gagccaatccgtgtcgtccataaagcagaagatggtaccatcttacaagaataccgcctc
catctcacaagcgatgcagaaaaactgaaacaatctgctccagtagcagtggaagcaggt
cgacgttttgtcaaagtcggtcaaaatctggttttaccatctacagtaggcgtctacttc
aaaggagatacaggctatgaccgcaaggaattgaccgtggactggcaagctgtaccagct
gatgcgctttctcatgaaggcaactttacgctagaaggaaaagtcattggttataatctg
acagctcagctgaccgttcgggtgtcagaaaagacaggagaaatcctctctgtgaaccgt
gactacaatgcagaggatagcagagcatttgccagtgaaaccaatgatctcgatccaaac
caaatcgactatatcgattacatcaatgatggtggctacaacgagtattatcgttggacc
aactggaagagagaaccagatcaaacagaagtgtttgccggtctcatcttcaagaaaaat
ggtcaagtaacagagcgtttagtcaataaagtagcggtcgacttctttgcagatcaggaa
acaggcctgccaaccaagacggttcttgaacgctatattggcccagactttgatgttccg
gatgattatggcaatctgaaaaaccttccagaacatccatttaaccaagcctctaactgg
gaagaaattccttatagcttggattacgcctttgagcctggttatatctctaacctcagc
ttcaatgaaaccagaaccaaagccatgcgtttaagaatggtccgtgatgaaaatctaaaa
ggaattggaatcgttgaattgagtgcctatgctccaactgaagaacctaatgcaacgacg
gatgtctctatccaagtaaatggcaaagagttggaagggttcaatccggatgtgacggat
tatcatctagagtacgagggagaacgtccaatagtttcagcacaaggtaagaatggagca
gccgttacagttgttgatgctaaagattctaatgcacctgtccttgtcaaggttgtatca
gaagatggtaagatagagaaaatatatcaaatctcactcctagcgaaagcaccaataggc
tcagctattcctgaagaaggtgtgaagaatttggtccataccaagccagagttggtgatt
gagccagaagagatggactttgaacgcttagaacgtccaaatgcggaacttccaaaagga
gagaaacgtgtggttcaagaaggtcaaaaaggccgcaaattgcgcttggtggaagtttct
caagaaaatggtgtggaaagccggaagaaactggatgcctttgtagagctagatccagtg
gcagaaatcacagaggtgggcacgaaagaagtacttccagacactccacaaccagagcca
cagccagaacctcagccacaaccagagccacaaccgcaaccacagccagagccgcaacca
cagccacagccagagccgcaaccacggccagagccacaaccgcttccgaacccagaacat
cctcatggctcagaaggaccagtagctaccccaactcctcaaacatctcttgaggtcaaa
gcagtgcgtcaggaagggacagatgcagcagggaaggaagtcgagaaaacagctcaaacg
ccagcagtttcagcaacttcagtttccgaaggtagattaccaaatacaggaacggaagaa
agcgtcgcaagccttgtggcaggtctcttagcagcaggtcttgccggtgctgtgctggat
gatcagaaaaaaagagccgataaggccaagtaa

DBGET integrated database retrieval system