KEGG   Setaria italica (foxtail millet): 101756109Help
Entry
101756109         CDS       T02818                                 

Definition
(RefSeq) hexokinase-6
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
sita  Setaria italica (foxtail millet)
Pathway
sita00010  Glycolysis / Gluconeogenesis
sita00051  Fructose and mannose metabolism
sita00052  Galactose metabolism
sita00500  Starch and sucrose metabolism
sita00520  Amino sugar and nucleotide sugar metabolism
sita01100  Metabolic pathways
sita01110  Biosynthesis of secondary metabolites
sita01200  Carbon metabolism
Module
sita_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sita_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sita00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    101756109
   00051 Fructose and mannose metabolism
    101756109
   00052 Galactose metabolism
    101756109
   00500 Starch and sucrose metabolism
    101756109
   00520 Amino sugar and nucleotide sugar metabolism
    101756109
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    101756109
Enzymes [BR:sita01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     101756109
Membrane trafficking [BR:sita04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    101756109
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 DUF3824 DUF4381 Sir1
Motif
Other DBs
NCBI-GeneID: 101756109
NCBI-ProteinID: XP_004969912
UniProt: K3XGV8
LinkDB All DBs
Position
V
AA seq 505 aa AA seqDB search
MGKGAVVGTAVVVCAAAAAAVGVAVVVSRRRRRRREAENERKRKAAAVIEEVEQAFSTPT
ALLRGIADAMVVEMERGLRADPHAPLKMLISYVDNLPTGDEHGLFYALDLGGTNFRVIRV
QLGGREKRVVKQQYEEVSIPPHLMVGTSTELFDFIAAELEKFVRTEGEDFHLPDGKQREL
GFTFSFPVHQTSISSGTLIKWTKGFSINGTVGEDVVAELSRAMERQGLDMKVTALVNDTV
GTLAGGRYVDNDVAAAVILGTGTNAAYVEHANAIPKWNGLLPRSGNMVINMEWGNFRSDK
LPSSEYDKALDFESLNPGEQIYEKMISGMYLGEIVRRILLKLAHDASLFGDVVPPKLEQL
FVLRTPDMSAMHHDTSHDLKHLGAKLKDILGVPDTSLEARYITLHVCDLVAERGARLAAA
GIYGILKKLGKDKLPNDFSQQRTVVAMDGGLYEHYKKFSACLEATLTDLLGEEAASSVVV
KLANDGSGIGAALLAASHSQYAEAA
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atggggaagggcgcggtcgtcgggacggcggtggtggtttgcgccgcggccgccgcggcg
gtcggggtggcggtggtggtgtcgcggaggaggcggcgccggcgggaggccgagaacgag
aggaagaggaaggcggcagcggtgattgaggaggtggagcaggcgttctccacgcccacc
gcgctgctgcgcggcatcgcggacgccatggtggtggagatggagcgcggcctgcgcgcc
gacccgcacgcaccgctcaagatgctcatcagctacgtcgacaacctccccaccggggat
gagcatggactgttttatgcactggatcttggcgggaccaactttcgtgtcatacgggtt
caacttggaggaagggagaagcgtgttgtgaagcaacaatacgaggaggtctccattccg
cctcatctgatggttggaacttccacggagctattcgatttcattgctgctgagttggaa
aaatttgtgcggactgaaggagaggatttccacctaccagatggcaagcagagagaactg
ggtttcaccttttctttccccgtgcaccaaacatcaatatcatcgggcactctaattaag
tggaccaagggcttttccatcaacggcacggttggagaagatgtcgtggctgaattgagt
agggctatggagaggcagggtcttgatatgaaagttacagccctggttaatgatactgta
ggcacattggctggcgggagatacgttgataatgatgttgctgctgctgtaatattgggc
actggcacaaatgcagcttatgtggaacatgcaaatgcgattcctaaatggaacgggcta
ctacctagatcaggaaatatggtaatcaacatggaatggggaaacttcaggtcagataag
cttccaagttcagagtatgacaaagccttggactttgagagcttgaaccctggcgagcag
atatatgaaaagatgatttctggaatgtatcttggagaaattgtgcggaggatcctgctg
aaactggctcatgacgcatcgttgtttggggatgttgttccgccaaaattggaacaactt
tttgtactgagaacgccggatatgtcagccatgcatcatgacacctcacatgatctcaaa
cacctgggagccaagctcaaggatattctgggggttcctgatacttccctcgaagcaaga
tacattactcttcatgtatgtgaccttgtcgcggagcgaggtgcacgcttggctgctgct
ggtatatatggcattctgaagaagctaggcaaggacaaattgccaaatgactttagccaa
caaaggactgtggtcgctatggatggtggcttatatgagcattacaagaagttcagtgcc
tgcctggaagcgacacttacagatctgctcggtgaggaggctgcctcgtcggttgttgtc
aagttggccaacgatggctcaggaatcggagctgcgcttcttgcagcctcacactcccag
tatgctgaagctgcatag

DBGET integrated database retrieval system