KEGG   Setaria italica (foxtail millet): 101761945Help
Entry
101761945         CDS       T02818                                 

Definition
(RefSeq) probable glutathione S-transferase parC
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
sita  Setaria italica (foxtail millet)
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:sita00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    101761945
Enzymes [BR:sita01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     101761945
Transporters [BR:sita02000]
 Other Transporters
  Pores ion channels [TC:1]
   101761945
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
II
AA seq 224 aa AA seqDB search
MADLPEVVLLDFWVSPFGQRCRIALAEKGVPYKYREQDLLLSKSELLLRSNPVHKKIPVL
LHAGRPVCESLAIVEYIDEVWPQAAPLLPRDDPYGRAQARFWADYIDKKIYGCQSRLWKL
KGEAQEQARKDLIEALKTLEFELDDKPYFGGENFGFVDIALVPFTCRFLAYEKLGSFSIE
EHCPKIVAWAKLCKERESVAKVLPDPDKVFEFIQFIRISKFGAK
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atggcggaccttccagaggtggtgctcttggacttctgggtgagccccttcggacagcgc
tgccggatcgcgctggccgagaagggcgtcccctacaagtaccgcgagcaggacctcctc
ctcagcaagagcgagctgctcctccgctccaaccccgtgcacaagaagatccccgtcctg
ctccacgccggcaggcccgtctgcgagtccctcgccatcgtcgagtacatcgacgaggtc
tggccacaggcggcgccgctcctgccccgggacgacccctacggccgcgcgcaggcacgc
ttctgggccgattacatcgacaagaagatctatggctgccagagtcggctatggaagctc
aagggtgaggcccaagagcaggccagaaaggacctgatcgaggccctcaagaccctagag
ttcgagctcgatgacaagccctacttcggcggcgagaacttcggcttcgtagacattgcc
ctagtgcccttcacctgccggttcctcgcctatgagaagctcggcagcttcagcattgag
gagcattgccccaagatcgtcgcatgggccaagctctgcaaggagcgtgagagcgtggcc
aaggtgctgcctgaccccgacaaggtgttcgagttcatccagttcatccggatcagcaag
ttcggggccaagtag

DBGET integrated database retrieval system