KEGG   Setaria italica (foxtail millet): 101763632Help
Entry
101763632         CDS       T02818                                 

Definition
(RefSeq) ribulose bisphosphate carboxylase small chain, chloroplastic-like
  KO
K01602  
ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
sita  Setaria italica (foxtail millet)
Pathway
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Carbon metabolism
Module
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Photorespiration
Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:sita00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    101763632
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    101763632
Enzymes [BR:sita01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     101763632
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
III
AA seq 168 aa AA seqDB search
MAPTVMASSATSVAPFQGLKSTAGLPVSRRSISTGFVSNGGRIRCMQVWPAEGNKKFETL
SYLPPLSTDEVLKQIDYLIRKNWIPCLEFSKIGFVYRENSTSPCYYDGRYWTMWKLPMFG
CTEATQVYAEFEECKKAYPDCYIRIIGFDNIKQVQCVMFIAYKPPGSE
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atggcgccgaccgtgatggcctcgtcggccacctcagttgctccattccaggggctcaag
tccaccgccggactccccgtgagccgccgctccatcagcaccggcttcgtcagcaacggc
ggaaggatcaggtgcatgcaggtgtggccggcggagggcaacaagaagttcgagaccctc
tcctacctgccacctctctccacggacgaggtcctgaagcagatcgactacctgatccgg
aagaactggatcccctgcctcgagttcagcaagatcgggttcgtctatcgtgagaacagc
acgtctccctgttactacgacgggcgctactggaccatgtggaagctgcccatgttcggc
tgcaccgaggccacccaggtgtacgctgagttcgaggagtgcaagaaggcctaccccgac
tgttacatccgtatcatcggcttcgacaacatcaagcaggtgcagtgcgtcatgttcatc
gcctacaagcccccgggcagcgagtag

DBGET integrated database retrieval system