KEGG   Solibacillus silvestris StLB046: SSIL_2519Help
Entry
SSIL_2519         CDS       T02162                                 

Definition
(GenBank) NAD-dependent aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
siv  Solibacillus silvestris StLB046
Pathway
siv00010  Glycolysis / Gluconeogenesis
siv00071  Fatty acid degradation
siv00280  Valine, leucine and isoleucine degradation
siv00310  Lysine degradation
siv00330  Arginine and proline metabolism
siv00340  Histidine metabolism
siv00380  Tryptophan metabolism
siv00410  beta-Alanine metabolism
siv00561  Glycerolipid metabolism
siv00620  Pyruvate metabolism
siv00625  Chloroalkane and chloroalkene degradation
siv01100  Metabolic pathways
siv01110  Biosynthesis of secondary metabolites
siv01120  Microbial metabolism in diverse environments
siv01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:siv00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SSIL_2519
   00053 Ascorbate and aldarate metabolism
    SSIL_2519
   00620 Pyruvate metabolism
    SSIL_2519
  Lipid metabolism
   00071 Fatty acid degradation
    SSIL_2519
   00561 Glycerolipid metabolism
    SSIL_2519
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SSIL_2519
   00310 Lysine degradation
    SSIL_2519
   00330 Arginine and proline metabolism
    SSIL_2519
   00340 Histidine metabolism
    SSIL_2519
   00380 Tryptophan metabolism
    SSIL_2519
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SSIL_2519
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SSIL_2519
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SSIL_2519
Enzymes [BR:siv01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     SSIL_2519
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC DUF1104 Hormone_recep
Motif
Other DBs
NCBI-ProteinID: BAK16942
UniProt: F2F4X7
LinkDB All DBs
Position
complement(2565681..2567108)
Genome map
AA seq 475 aa AA seqDB search
MLNHTKQYINGEWVNSTGTDTIEVINPATEEVVGKISSGTEEDVNRAVQAAKEAFPAFSK
MSVDDRIKLLEAIAEEYEKRKDDLVNIMTAELGAPITKSEEIHYKMGLSHFKQAAEQLKT
FKFTEEREKSYIQKEPIGVAGLITPWNFPTNQISTKLASALAAGCTMVVKPASQTPFAAV
ILAEILDKAGVPKGVFNLVNGSGSTVGEAISSHPDVDIVSFTGSGEVGSGLMKNAAEGIK
NISLELGGKSPFVILEDADVKEAAKTALAQIAMNTGQVCSAATRMIVPEEMHDKFIEAMK
ELVTEFPVGDPQDKNTFMGPQVSKDQWETVQSYIKKGEEEGAKIVIGGLGRPDGIDKGFF
SQITVFTNVKNDMTIAQEEIFGPVMSVITYKDLDEAIDIANDTIYGLAGYVFGNDKEELK
KVALSIRAGQIRINNSETDRSAPFGGFKHSGIGREWGDYGIEEFLEPKAIMGMPL
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgctaaatcatacaaaacagtacatcaatggggaatgggttaattctactggaacagat
actattgaagttattaatccggcgacagaagaagtagttggtaagattagcagcggaact
gaagaagatgtgaatcgagcggtccaagcagcaaaggaggcgttcccggcattttctaaa
atgtcagtggatgaccgtataaagcttttagaggcaattgctgaggaatatgaaaaacgt
aaagacgatttagtaaatataatgaccgctgaactaggtgcgcctattacaaagtcggag
gaaatccactataagatggggctttcacactttaaacaggcggcagaacagttaaaaacc
tttaagtttacggaagaacgagagaaatcctatattcaaaaagaaccgattggtgtagca
ggtctgatcacaccgtggaatttccctacaaatcagatttccactaagcttgccagtgca
ttggcagcaggttgtacgatggttgtgaaacctgcttcccaaacaccatttgcagcagta
attctggcggaaattttggataaagccggtgttccaaaaggcgtatttaatcttgtcaat
ggttcgggttcaacagttggtgaggcaatcagttctcatccggatgtcgatattgtatcg
tttacaggatctggagaagtaggcagcggtttaatgaaaaatgctgcagaaggtattaaa
aatatctccttggaacttggaggcaaatcgcctttcgttattttagaagatgcggatgta
aaagaagcagcaaagacggcattggctcaaattgctatgaatactgggcaagtatgttct
gctgctacacgcatgattgtaccggaagaaatgcatgataagttcatagaggcaatgaaa
gaattagtaacagaattcccagttggcgatccgcaggacaaaaacacatttatgggtccg
caagtttcaaaagaccaatgggaaacggttcagtcctatattaaaaaaggtgaagaagaa
ggcgcaaaaattgtaatcggcggccttggcagacccgatggaattgataaaggattcttc
tcccaaataaccgttttcacaaatgtgaaaaatgatatgacaattgcacaagaggaaatc
tttggtccggttatgtcggttatcacttataaagatttagacgaagcaattgatattgcc
aacgatacgatttatggtcttgccggttatgtattcggaaatgataaagaagaactgaaa
aaagtcgctttatcaatccgagcgggacaaatccgtattaataatagtgaaacagatcga
tcggcaccatttggcggattcaaacattctggtattggccgtgaatggggcgattatgga
atcgaggaatttcttgagccaaaagcgattatgggaatgccgttataa

DBGET integrated database retrieval system