KEGG   Streptococcus iniae SFST01-82: SI82_03215Help
Entry
SI82_03215        CDS       T03674                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
siz  Streptococcus iniae SFST01-82
Brite
Enzymes [BR:siz01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     SI82_03215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
631832..632440
Genome map
AA seq 202 aa AA seqDB search
MAIILPELPYAYDALEPQFDQETMTLHHDKHHATYVANANAALEKHPEIGENLEELLANV
ESIPADIRQALINNGGGHLNHALFWELLSPEKTEVTKEVASAIDQAFGSFDAFKEQFAAA
ATGRFGSGWAWLVVTKEGSLEITSTANQDTPISEGKKPILALDVWEHAYYLNYRNVRPNY
INAFFEIINWNKVDELFKAAKA
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atggctattattttaccagaacttccatatgcatatgatgctttagagccacaatttgat
caagaaacaatgacacttcatcatgataaacaccatgcgacttatgttgctaatgctaat
gctgccttagaaaaacacccagaaattggtgaaaacttagaggagctcttggcaaatgtt
gagtctattccagccgatattcgtcaagctttaatcaataatggtggcggacacttgaat
catgctttgttctgggaattattatcacctgagaaaactgaagtaacaaaagaagttgca
agtgcaattgaccaagcttttggatcttttgatgcttttaaagaacaatttgcagcagca
gcaactggccgttttggttctggttgggcttggttagttgttactaaagaaggaagtctt
gaaattacttcaactgcaaatcaagatacccctatttcagaaggtaagaaacctatttta
gcacttgatgtttgggagcatgcttattaccttaactaccgtaatgttcgtccaaactac
atcaatgctttctttgaaatcattaactggaataaagtagatgaattatttaaagctgct
aaagcataa

DBGET integrated database retrieval system