KEGG   Saccoglossus kowalevskii (acorn worm): 100367443Help
Entry
100367443         CDS       T04123                                 

Definition
(RefSeq) hexokinase-2-like
  KO
K00844  
hexokinase [EC:2.7.1.1]
Organism
sko  Saccoglossus kowalevskii (acorn worm)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sko00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100367443
   00051 Fructose and mannose metabolism
    100367443
   00052 Galactose metabolism
    100367443
   00500 Starch and sucrose metabolism
    100367443
   00520 Amino sugar and nucleotide sugar metabolism
    100367443
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    100367443
Enzymes [BR:sko01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     100367443
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 448 aa AA seqDB search
MGDNKLETILECMHLNKDQLKSVKDRLHIEMMKGLGKASHANARVKMYPTYVRSTPDGTE
RGDFLALDLGGSNFRVLYIKIGEKVEQFSEVYKLTKELMEGTGEKLFDYIAECLANFIGK
QGLKDRALPLGFTFSFPCQQKGLASATLTMWTKGFKASGVEGKDVCVLLYEAVKRRGDIL
LDVIAVVNDTTGTLMSCAHAFPDCVVGLILGTGTNACYIEKLENVETWDGDTDPPKQVLI
NMEWGAFGDDGVLDDLRTEYDESIDKKTHNVGKQKFEKMISGMYLGELVRQILVKLAENH
VLFDGKTTEALRNSWKFETANLSQIEGDTSPDYKVCRKLMKDHGLEITDQGCKIVKAVCA
AVSSRAAQLAAAGIAAVACQVGKSDVTCGVDGSLYRKHPRFHDIMTATIKQLAPGVNVKF
VLSEDGSGKGAALVAAVAHTLKSKTKAE
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgggagacaacaaacttgagactatactggagtgtatgcatctgaataaagatcaattg
aaaagtgtcaaagatagactacatatagagatgatgaaaggtcttggtaaagctagtcat
gctaatgctagagttaagatgtatccaacatatgtgagatctactcccgatggtacagag
agaggtgattttctcgccctggatcttggtggcagtaacttccgtgtgttgtacattaag
attggtgaaaaagtagaacaattcagtgaagtttacaagctaaccaaagagctgatggaa
ggcactggtgaaaagttatttgattacatcgcagagtgtcttgctaatttcattggaaaa
cagggattgaaggacagagcacttccacttggattcacattttcgtttccgtgtcaacaa
aaaggtttggcatcagccactctgacaatgtggactaaaggtttcaaagcctcaggagtg
gaaggtaaagacgtttgtgtacttctgtatgaagctgtcaaacgtagaggggatatttta
cttgatgtgattgcagtggtcaatgatacaactggaacactcatgtcttgtgcgcatgca
tttcctgattgtgttgtaggtctcatacttggaactggtaccaatgcatgctatattgaa
aaacttgagaatgttgaaacctgggatggtgacactgatccccctaagcaagtgttaatt
aacatggaatggggtgcatttggtgatgatggagtacttgatgacttgagaacagagtat
gacgagtcaattgataagaaaacacacaatgtgggaaaacaaaaatttgaaaagatgatt
tctgggatgtatcttggtgaattagttcgtcaaattcttgtgaaattagctgaaaaccat
gttttatttgatggtaaaacaactgaggcgttaaggaattcatggaagtttgagacagct
aatctttcacagattgagggagatacaagtccagattataaagtatgcagaaaactcatg
aaggatcatggtcttgagataactgaccaaggttgtaaaatcgtgaaagctgtgtgtgct
gcagtgtcatctcgtgctgcacagctagccgcagctggtattgctgctgttgcctgccag
gtcggaaaaagtgatgtcacatgcggggtggatggatctctgtacagaaagcaccccagg
ttccacgacatcatgacagccacaatcaaacagttggctcctggtgttaatgtcaaattt
gttctttcggaagatggcagtggcaaaggagcagcattagtagcggctgtcgctcataca
ctaaagagcaagacaaaagcagaatag

DBGET integrated database retrieval system