KEGG   Saccoglossus kowalevskii (acorn worm): 100369068Help
Entry
100369068         CDS       T04123                                 

Definition
(RefSeq) protein-glutamine gamma-glutamyltransferase K-like
  KO
K05619  
transglutaminase 1 [EC:2.3.2.13]
Organism
sko  Saccoglossus kowalevskii (acorn worm)
Brite
Enzymes [BR:sko01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     100369068
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 731 aa AA seqDB search
MPRSRRTRAVAESRHGSAPYFYERSIPGRRIISSEEFNFFTPPESDKQLKVVSIDLEKKR
NSAEHHTEEYEVEELVVRRGQKFHLTVFLNQEFKEDSHKIELELRAGKRPRINYGTRVPI
PQVTTSQEDDWGIHVVKFEGNKIECVVYSAADCLVTKYKLFVETSVEGKDEFRFENPEEF
YMIFNPWCKADDVYMEDDSKRNEYVLNDFNRYYYGNSRTIGGSFWYQGQFEAVILPCALQ
LLDQSGIAKRNYSSPIHVVRALSAVLNSQDDNGVLEGNWSGDYEDGTEPTDWAGSVAILQ
QYVDTGKPVKYGQCWVFAGLFTTVLRALGIPARTVTNFESAHDTDGNLTLDYHYSEDGEP
LEDLNDDSVWNFHVWNDCWMARPDLPAGYGGWQAADATPQETSEGIFRTGPASLAAIKNG
DVYLGYDTKFIFAEVNAESVNWIVSKDKQLPEPVDVDPFKIGKNMSTKAVDSDDREDVTL
QYKHPEGSDRERLSVLSAIKHVKSAKKLHKDIKKDARFEVDIPDELMIGKPVDVKIKITN
DHMTDSREVVTTVTCNTVYYTGVKAHRVKVDKETLKIGPGETITHGLTIEVSDYQYLLTE
CAALKFFIMAGVKDTKQTFAGNFDFRFRKPDLEVTIDPSGELTIGDPFKATVMFTNPLPI
TLQFCSFRLEGAGIDGQIRKTVRNVPSGKDTELEVKLTPVKTGRRKLLASFHSKQLSGVT
GMASLEIVAAE
NT seq 2196 nt NT seq  +upstreamnt  +downstreamnt
atgcctagaagtcgcagaacccgtgcagtggctgagagtcgccatggaagcgcgccgtac
ttctatgaacgctcgattccagggaggcgaatcatttctagtgaggagttcaatttcttc
actcccccagaatcagataaacaattgaaagttgtaagtattgatttggagaaaaaaaga
aatagtgcggagcatcacacagaagagtatgaagtagaagaactggtagtacgtcgtgga
caaaaatttcatttgactgtattcttgaaccaagaatttaaagaagacagtcacaaaatt
gaactggagctgagagcagggaaacgaccacgtatcaattatggcactagagttcccata
ccacaagtgaccacatcacaggaagacgactggggaatacacgttgtaaaatttgaaggg
aacaaaatagaatgtgttgtctactctgccgctgattgccttgttacaaagtataaacta
tttgtagagacgtcagtggaaggaaaagatgaattcagatttgagaatccagaggagttc
tatatgatattcaatccttggtgtaaagctgatgatgtttacatggaagatgatagcaag
cgtaatgagtacgtcttgaatgatttcaatagatattactatggtaacagtaggacgatt
ggtggaagtttttggtatcaaggccagtttgaggctgtcatactgccatgtgctctgcaa
cttttagaccaatctggtatcgcaaagcgtaactattcaagtcccatacatgtggtcaga
gctctgtctgctgtgttgaatagccaagatgataatggtgtcctggaaggtaattggtct
ggtgattacgaggacggtactgaaccgacagactgggctggtagtgtagctatactacag
caatatgtagacactggtaaaccagtcaagtacgggcagtgttgggttttcgctggatta
tttactacagtattaagagctctaggaataccagcacgtaccgtcaccaactttgagtct
gcccatgatactgacggtaacctgacattagactatcattatagtgaagacggagaaccc
ttagaagacctcaatgatgatagtgtttggaatttccatgtgtggaatgactgttggatg
gcaagacctgatttgccagcaggctacggtggatggcaagcagctgacgcaacacctcag
gaaaccagtgagggaatatttcgtactggtcctgcttccttggctgctatcaagaatgga
gacgtctatctgggatacgatactaagtttatatttgctgaagtaaacgcagagtcggtc
aattggatagtatcaaaagataaacaattaccagaaccagtggatgtggatccatttaaa
atcggtaaaaatatgagtaccaaggcagtagacagcgatgacagagaggatgtaactcta
cagtataaacacccagaaggttcagaccgtgaaagactgtctgtattatctgcaatcaag
catgtaaaatctgcaaagaaactccataaagacattaaaaaagacgcaagatttgaggtg
gacatacctgacgaattgatgattggtaaaccagttgatgttaaaatcaagatcactaat
gaccacatgactgattctcgtgaagtagttaccacggtaacatgcaatacagtttattac
acaggtgtcaaagcacatagagtgaaggtcgataaggagactctgaaaataggccctggg
gaaaccattactcatgggctaacaattgaagtatcagattatcagtatctgctgacagaa
tgtgctgctttaaaattcttcatcatggctggtgtgaaagatactaaacagacatttgct
ggaaattttgactttagattccgcaaacctgatctggaagtcacaattgacccctctggt
gagctgacaataggagatcccttcaaagctactgtcatgttcaccaatccactgccgatc
actttacagttctgttcatttcgacttgaaggagctggtatcgatggacagattagaaaa
actgtcagaaatgtgccaagtggcaaagacactgaattagaagtgaaactgacaccagtc
aaaactggtcgccgtaaattattggctagttttcactcaaaacagctcagtggtgtgact
ggcatggcaagtctagaaatagtagcagcagaatag

DBGET integrated database retrieval system