KEGG   Saccoglossus kowalevskii (acorn worm): 100372808Help
Entry
100372808         CDS       T04123                                 

Definition
(RefSeq) histone-lysine N-methyltransferase SUV420H1-B-like
  KO
K11429  
histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
sko  Saccoglossus kowalevskii (acorn worm)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:sko00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100372808
Enzymes [BR:sko01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100372808
Chromosome [BR:sko03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100372808
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 930 aa AA seqDB search
MVIETFQSTRYAPSTGMSSKELCENDDLATSLVVDPFLGFPSHKMNIRFRPVTSKTEHLR
GTVDKYKEHKISLETAFKALTSGHWYRLYFLNKSKNQQNTFKEHVFRYLQTFSEESGFEV
KSCCRYSLEGQGAKIVSTKQWEKNEKISLLVGCISELTPLEENQLLRAGENDFSVMYSTR
KNCAQLWLGPASFINHDCRPNCKFVSTGRDTACVQVLRDIEPEEEITCFYGDGFFGEDNC
YCECETCERRKTGAFTPQNPSEKDVLKETSYRLRETDNRLSRMKRKSEEGKKSRQNGRCP
VSYRSRGRSSSGRSGRSRQRSDKSTSDSGFQRSSYSSSYSKQRNSELTKYDAALIKSHGC
KLSEPVIVLTPQKLSPSQIVKLGPKGEVIGVSRRKLKFNDAEDGQTAVVKPSGRVQPGNS
ELADQLDSMLKFEDYEYTSKIKDETETEYISEPTFNCQDSSMELKKVYNDASEDDWPDWK
CIPSPKYEIKQGEECSKVGNDYEAMQDCTLESAGVDPCEQMQSCQSRNNSNSVDVATEIL
AYSGDASVSSDNCVMNLISATSQTVSSPARAYQTELVPDTGGTKLRIKAPRPHTYNRAVM
ECNSGDIVMEQLQNGDSFGSLQYCRLKMKNTGVSQIAASHSTQQLVRSTVEEHRISSTNG
KIEKKRKKNRWDPISKEWTRTKKKMVKYNATLLSHHDDKIPKLTIRFARCIESDNSSSEE
ENQRTSSASKIFLKVKPPSSETETFASKERDLLKRNKKRQWQKNLHFNGYSRKKTKKSKQ
KGKKKVKTVHQFAPRLSQLRELYENPEHPSFHKVVDHFSPRLSQLNSSSFVKFGESSSEF
EEQIKNCPQSGEFKWDNSDGDNCETPESLIPSSSGDEEDDNTLIDSHLHLKPYLPKKLKM
IVGKDRFEVAIPEQSQSQELTDEQSSSPEN
NT seq 2793 nt NT seq  +upstreamnt  +downstreamnt
atggtgatagagacttttcagagtacgcgctacgcaccttctacaggaatgtcatcaaag
gaattatgcgagaatgatgatttagccacaagtctcgtcgttgatcctttcttgggattt
ccttcacacaaaatgaacataaggtttcgtccagtgacaagtaaaactgaacatctacga
ggaactgtagacaaatacaaagagcacaaaatcagtctagagactgcctttaaagcttta
acctcagggcattggtatagattatattttcttaacaagtccaagaatcaacaaaatact
ttcaaagaacatgttttcagatatttacagacgttctcagaggaatcagggtttgaagtg
aagtcttgttgtcggtattcattggaaggacagggtgccaaaattgttagtacaaaacaa
tgggaaaaaaatgaaaaaatttcattattggttggttgtatttctgaactcacacctctt
gaagagaatcagttactcagggcaggtgaaaatgacttcagtgtcatgtattctactagg
aagaattgtgcacaattgtggcttggacctgcttcatttatcaatcacgattgtcgaccc
aactgtaagtttgtatcaactggtcgtgatactgcttgtgttcaagtgttgagagacatt
gaaccagaagaagaaattacctgtttctatggcgatggtttctttggtgaagacaattgt
tattgtgaatgtgagacttgtgaaaggagaaagacaggtgcctttactccacagaaccca
tctgaaaaagatgtgctaaaagaaacatcttacaggttgagggaaactgataacagactt
tcaagaatgaaacgcaaaagtgaagagggcaagaagtcccggcagaatggcaggtgtcct
gttagttacagatctagaggaagatccagtagtggtcgaagtggaagatcaagacagcgt
agtgacaaatcaacaagtgattcaggttttcagagatccagttatagctccagttacagc
aagcaacgaaactctgagctaaccaaatatgatgctgcactcattaaatctcatggatgc
aaactatcagagccagtcattgtactaacacctcaaaaattaagtccatcccaaatagtt
aagcttgggccaaaaggcgaggtcataggtgtttcacgtaggaaattaaagtttaatgat
gccgaggatggacagacagctgtagtaaaaccatcaggacgtgtacaacctggtaatagt
gaacttgccgatcagttggattccatgctgaaatttgaggattatgaatacaccagtaaa
ataaaagatgaaactgaaactgagtatatttccgaaccaactttcaattgtcaggactct
tcgatggaattgaagaaagtatataatgatgcttctgaagatgattggcctgactggaaa
tgtattccctctccaaaatatgaaattaaacagggagaggaatgttcaaaagttggcaat
gattatgaagctatgcaagattgcacacttgaatccgcaggtgttgatccctgtgaacaa
atgcagagctgccagtccaggaacaatagcaattcagttgatgttgctactgaaatatta
gcttattcgggtgatgcttcagtatcgtctgacaactgtgtcatgaatctgatttctgct
acttcacaaacagtatcatctccagcacgtgcttaccaaactgaacttgtacctgacaca
gggggaactaagttacgtattaaggcacctcggcctcatacttataacagagcagttatg
gagtgtaattctggtgacattgtcatggaacagctacaaaatggagattcctttgggtcg
ctgcaatattgtagactgaaaatgaaaaacactggagtgtctcagattgcagcaagtcac
agcacacaacaacttgtcaggagtactgtagaagaacatagaatttcttcaacaaatggt
aaaatcgagaaaaaaagaaaaaaaaatagatgggatcctatcagcaaagaatggactcga
acaaagaaaaagatggtaaaatacaatgctactttactatcacaccatgatgataagatc
cccaaattaacgataaggtttgcaaggtgtattgaaagtgacaacagcagcagtgaagaa
gaaaatcagagaacctcctctgcttctaaaattttcttgaaggtcaagccacctagttca
gaaactgaaacatttgcatcaaaagagagagatctgctaaaacgcaacaaaaaaagacaa
tggcagaaaaacttgcattttaatggttactctcgaaaaaaaacaaagaagtcaaagcaa
aaggggaaaaaaaaagttaagacagttcatcagtttgcccccaggttgtcacaacttcgg
gagctgtatgaaaatccagagcacccttcatttcataaagttgttgaccacttttcacca
agattgtcacagctcaatagctcttcttttgtaaagtttggtgaatcatccagtgagttt
gaggaacaaattaaaaattgtccacagtcaggggaatttaaatgggataactcagatggt
gacaactgtgaaacgcccgagagcctgattccatcatcgtctggagatgaggaagatgac
aatacactgatagattcacatctgcatcttaaaccatacttgccaaagaaacttaaaatg
attgttggaaaagacagatttgaagtggcaataccagaacaaagtcaaagtcaagaactc
actgatgaacaaagctcttctcctgaaaactag

DBGET integrated database retrieval system