KEGG   Saccoglossus kowalevskii (acorn worm): 100373316Help
Entry
100373316         CDS       T04123                                 

Definition
(RefSeq) uncharacterized LOC100373316
  KO
K08670  
suppressor of tumorigenicity protein 14 [EC:3.4.21.109]
Organism
sko  Saccoglossus kowalevskii (acorn worm)
Brite
Enzymes [BR:sko01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.109  matriptase
     100373316
Peptidases [BR:sko01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   100373316
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 939 aa AA seqDB search
MILNVKNICERTSESTATYEQNGFGGVMERVSNSSYVEVLSSSEKASMILAAILLMVTIV
VGTIGNSLVCVTVCTNRKLRTPSNFQLVSLAIADTMVCLVSASIRLYLSIRILTCGSNSV
NNFSQNTNMAVCKLQAFSMFSAVIISLVTMATLSVTRALGISGYVMGDSLKLLVLVFVSL
SYGLGVVYGAIRAIAAPDITCFLVGRQSTVADSSAFLGAVILVISIVVVLLSYCCICRIN
RRHRASMLPWLKDAHLNRINKRDIATIRVSATLVVSFFLTYLPGAIYFMMSSTSDVITQN
PFYFNLTVVLVNRAACEPLTVSLCYSHVDFNTTVFPNEYANSQSIAESRISSLEYLKTCH
EKSLFFVCNLYAPECINEGEYLLPCQSLCEEVLAVCSATIDGIVWDIDCEDLPNDYRSTV
CVGGTAPEDEFRCDNGECINGDYRCDDTYDCIDYTDEDNCDCADYRYIECKGYNECINPV
WVCDGTADCTDSSDEIYCDSYQSPSCSQMSYLYWACSDDSACIYNSWRCDGVTDCLDLSD
EAICVPCADGFTPCSDDGLCIPDEWVCDAYPDCGDGSDEQSCPSTTCEPGKFVCGTGWCL
TPTWVCDGFDDCGDGSDESVATCDLCTDVQFRCADGTCIAISEQCDGNDDCGDSSDENDC
TCNSNQFTCDDGSCVSLSMQCDGNNDCSDDSDETVCECGTVTVPLSRIVGGINAELGEWP
WQVSLQTQGSHFCGGTLVRPQWVVTAAHCVVDEVASNFEVHMGMSMHAEWAQTETRVVKD
VNRIIVHSSYDVDTQDYDIALLELSSAVQLNDYIRLACLPSSDMDFPDGKDCSISGWGYT
EEGGDSPYVLQMASVPLVSITDCAVLLSITTRMICAGYPEGGIDSCQGDSGGPLVCYMDD
SKWYLAGAVSWGIGCARPRKYGVYARITYFRDWIDGYIT
NT seq 2820 nt NT seq  +upstreamnt  +downstreamnt
atgattttgaatgtgaaaaatatatgtgaacgcacttccgagtccacagctacatatgaa
cagaacggttttggtggagtcatggaacgcgttagcaacagctcatacgtcgaggttctg
agttcgtcggaaaaagcatcgatgatactagcggcaatcttgttaatggtgacaatcgtt
gtaggtaccatcggtaacagcttggtatgcgtcactgtgtgcacaaatcgaaaactacga
acaccgtccaattttcaactcgtatcattggctatagctgacaccatggtgtgtctggtg
tcggcgtcaattcgcttgtatctaagtattcgtattctgacgtgcgggtcaaactcagtc
aacaatttttcgcaaaatacaaatatggctgtatgcaaactacaggcattttctatgttc
tccgcggtgataatatctttggtcaccatggcaactctgagtgttactcgagctctcgga
atcagtggttacgtcatgggcgatagtctgaaattgttagtactcgtattcgtcagtctt
agttacgggctaggtgttgtgtacggggccataagggcgatcgcagctcctgacatcacg
tgctttctagtcggacgccagtctacagtagcggatagctcggcatttctgggtgctgta
attttagtgattagcattgttgtcgtgttgttgtcgtactgctgcatatgtcggataaat
cgacgtcaccgtgcgtctatgttgccgtggctcaaagacgcgcacctgaaccgaattaat
aaacgtgacatcgccaccattcgcgtgtcggctacattggttgttagtttctttcttacg
tatctacctggggccatctacttcatgatgtcatcaacaagtgacgtaatcacacagaat
ccgttttacttcaatctaactgtcgtgttggtcaatagagcggcatgtgagcctttaacc
gtgtctctttgctatagccatgttgatttcaacaccaccgtgtttcctaacgagtacgcg
aacagtcaatcaatcgcggagtctcgaatatcatcgcttgaatacctcaagacgtgtcat
gaaaagtcattattttttgtctgtaacctatatgcacctgagtgtataaatgagggtgaa
tatcttctaccttgtcagtctttgtgtgaagaagtattagcagtgtgcagcgctacaatt
gatggcatagtgtgggatattgattgcgaagatttgccaaatgattaccgttcaacagtg
tgtgtgggaggaacagctccagaagacgagtttagatgcgacaacggcgagtgcattaac
ggagattatagatgtgacgacacatatgactgtatcgactatacagacgaggacaattgt
gactgtgccgactaccgttatatagaatgtaaaggatataatgaatgtatcaaccctgta
tgggtatgtgatggaactgctgactgtactgactcaagcgatgaaatctactgcgacagt
taccaaagccctagttgttcccaaatgtcgtacctttactgggcgtgcagcgatgactcg
gcctgtatatataatagttggcgatgtgacggcgtcactgattgcttagatttaagcgac
gaggcaatttgcgttccttgcgctgacggatttacgccgtgttctgatgacgggttgtgt
atccccgatgagtgggtctgtgatgcctacccggactgcggggacgggagtgatgaacag
tcatgtccatctaccacatgtgaacccggaaagtttgtgtgtggtactggttggtgcctg
acaccaacgtgggtatgtgatggcttcgacgactgcggggacggttctgatgaaagtgtg
gcaacatgcgatctgtgtacagatgttcaattccgatgtgccgatggtacttgcatagca
atcagtgagcaatgtgatggcaacgatgattgtggcgacagctccgatgaaaacgactgt
acatgcaacagcaatcaattcacctgtgatgacggtagttgtgtgagcctttcaatgcaa
tgtgatggaaataacgactgttctgacgacagcgacgagactgtatgtgaatgtggaacc
gtaacagtgccactgtcgcgaatcgttggcggtatcaacgcagagctcggcgaatggccg
tggcaagtctcattacaaacgcaaggatcccatttctgtggaggcacattagttcgcccg
cagtgggttgtaactgctgcacattgtgttgtcgatgaagttgctagcaactttgaggtg
cacatgggtatgtcaatgcacgctgaatgggcgcagactgaaacacgtgtcgttaaagat
gtcaaccgtataatcgtgcatagcagttacgacgtggacacacaagactacgacatagcg
ttgcttgagctcagttccgcggttcaactaaatgactatatacgactggcgtgtttaccg
tcgtcagatatggatttcccagatggcaaagactgttccatttctggatggggttatacc
gaggaaggtggtgattcaccgtatgttctacaaatggcatctgtaccactcgtatccatc
actgattgtgccgtacttttatctataacaacgagaatgatatgtgcaggctacccagag
ggtggaattgattcctgtcagggagacagtggtggaccattggtttgctatatggacgat
tccaagtggtatttggcaggggcggtgagttggggtatcggatgtgctaggccgcggaaa
tatggagtatacgcacgaatcacatacttccgagactggattgatggctacataacataa

DBGET integrated database retrieval system