KEGG   Saccoglossus kowalevskii (acorn worm): 100377374Help
Entry
100377374         CDS       T04123                                 

Definition
(RefSeq) beta-1,3-galactosyltransferase 1-like
  KO
K07819  beta-1,3-galactosyltransferase 1 [EC:2.4.1.86]
Organism
sko  Saccoglossus kowalevskii (acorn worm)
Pathway
sko00601  Glycosphingolipid biosynthesis - lacto and neolacto series
sko01100  Metabolic pathways
Module
sko_M00070  Glycosphingolipid biosynthesis, lacto-series, LacCer => Lc4Cer
Brite
KEGG Orthology (KO) [BR:sko00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    100377374
Enzymes [BR:sko01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.86  N-acetyl-beta-D-glucosaminide beta-(1,3)-galactosyltransferase
     100377374
Glycosyltransferases [BR:sko01003]
 Glycan extension
  Type 1 chain
   100377374
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Galactosyl_T Fringe
Motif
Other DBs
NCBI-GeneID: 100377374
NCBI-ProteinID: XP_006816641
LinkDB All DBs
Position
Un
AA seq 368 aa AA seqDB search
MVAQGRFLSNFLLLFVLALANIIVFLYFTHPTLLNLRHETPNDVLRSNQNLLDTMLSNTL
DNGTVFHESKQSSESGNDKKESQPSVNQFPIDLKKRPILAHDFKLVINHPDKCMNPDGTP
AEVFLLVLINSIHRNFEQRQAIRDTWGNPTMVNGQRIITMFLLAKVHDDKLQALVLQENE
RFGDLLMEDFDDTYMNLTLKSIMGFKWANNYCSHARYGMKTDDDMFVNYETLVKLLIDSL
DKEFAVGFLINGSPIRDVKSKWYMSRDVYPDSKYPPFLSGTGYVMSMDVMCNTYKVALET
PFLYLEDVFVAVCWNKLGIVPRKHPEFHNWKKVYSLCRYRKIITSHMVTPNEMYRIWRDM
AAKKSISC
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atggttgctcaaggaagatttttgtcaaattttctgctgctatttgtgctagcgttggca
aatattatcgtatttttgtacttcacccatccaactttattgaacttgagacatgaaaca
ccaaatgatgtgttgcgaagtaatcagaatttgcttgacacaatgttaagtaacacttta
gacaacggcactgtgttccatgaatccaagcagtcaagtgaaagcggcaatgataaaaaa
gaaagtcaaccgtcagttaaccagttccccattgatttaaaaaaaagaccaatattggca
catgattttaaacttgtgatcaaccatccagataagtgtatgaatccagatggcacacct
gctgaagtgtttctcttggtactcatcaactcaatacataggaattttgagcaaagacaa
gcaatccgagacacttggggaaaccctactatggtgaatggtcagcgaattataacaatg
tttcttctagcaaaagtacatgatgacaaactccaggccttggttctccaagagaatgag
agatttggggatcttttgatggaagattttgacgatacttacatgaacttaacattgaaa
agcataatgggtttcaaatgggcgaataattattgctctcacgcgagatatggcatgaaa
acagatgatgatatgtttgtcaattatgaaacacttgtcaagcttttaattgactcactt
gacaaagaatttgcagtgggatttcttataaatggttctcccatcagggacgttaaaagt
aaatggtacatgtctcgcgatgtctatcctgatagtaaatatccaccgtttctttcgggt
actggctatgtcatgtcaatggatgttatgtgtaatacttataaagttgcattagagacg
ccatttctatatcttgaagatgtgtttgttgctgtctgctggaataaacttggcattgtg
ccaagaaaacatcctgagtttcacaactggaaaaaagtttactcactttgtcgctatcgt
aagataataacatcacatatggtcacgcctaacgagatgtacagaatatggcgtgacatg
gcagcaaagaagagcatttcgtgttaa

DBGET integrated database retrieval system