KEGG   Saccoglossus kowalevskii (acorn worm): 102805066Help
Entry
102805066         CDS       T04123                                 

Definition
(RefSeq) cell division cycle protein 23 homolog
  KO
K03355  
anaphase-promoting complex subunit 8
Organism
sko  Saccoglossus kowalevskii (acorn worm)
Pathway
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:sko00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    102805066
Ubiquitin system [BR:sko04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     102805066
Chromosome [BR:sko03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   APC/C complex
    102805066
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 584 aa AA seqDB search
MAAPITSSAFPPSTQLIDLPNVKSELLFTIKECSSRGLLNSVKWAAELSCALSVTEPSSL
PKEEDFQDFLQEFDKYTLAKAYFDLKEYDRAAHVVKQCKSAKAYFLHMYARYMSGEKKRY
DEMPDPLGPMEYSDIKTESLKTLRMELSQLHQHHKLDGYSAYLYGAVLKKLGLFKEAREV
LIEAVNKTPLHWGGWLELSSLITDINMISSVSFPNHWIKEFFLAHIYLELQMHEEALLKY
DFLKEAGFHKSTYIMAQIAMATHNMRDADIAVDLFAELQEVDPYRLEHMDIYSNLLYVKE
MKPELGYLAHKCCEIDKYRVETCCVIGNFYSLRSQHEKAALYFQRSLKLNPHYLAAWTLM
GHEYMEMKNTSAAIQAYRQAIEVNRRDYRAWYGLGQTYEILKMPFYCLYYYKQAQKLRPN
DSRMLVALGESLEKLERIQAAKKCYWRAYSVGDVEGQALIKLAKLHENLKEEEQAATFYA
KFVEQSEVMGTVETEERCHAYYFLADYYMKQGSYEEASSYAHKCCAYNETKENGKAILRQ
IANLRVTSEVSKPDDSPSEHCMKVSNENTPMRTGISPMDLTFTP
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atggcagcccctatcacgagcagcgcctttcctccgtcgacgcaactaatcgaccttccc
aacgttaaaagcgaattgttattcaccatcaaagagtgtagttctagaggtcttcttaat
agtgtcaaatgggcagcagaattatcctgtgcattgagtgttactgagccatcttctttg
ccaaaggaggaggattttcaggatttcttgcaagaatttgacaaatatactttggccaag
gcgtactttgatttgaaggagtatgacagagcagctcatgtagtgaagcaatgtaaaagt
gccaaggcctattttcttcatatgtatgcaaggtacatgtctggtgaaaaaaagagatat
gatgaaatgcctgatccgcttggaccaatggaatattctgatataaagactgagtcattg
aagactctgagaatggaactaagtcagctacaccaacatcacaaacttgatggatattcc
gcgtatctgtatggtgctgtgttaaagaagttaggacttttcaaagaagccagagaagtt
ttgattgaagctgtcaacaagacacctctacactggggtggttggttggagttatctagt
ttgattacagatataaatatgataagttcagtttcatttccaaatcactggataaaggaa
ttctttctagcgcacatttaccttgaactacaaatgcatgaagaggcactactaaagtat
gatttcttgaaggaagcagggtttcataaaagtacttatatcatggcacagattgccatg
gcaacacataacatgagagatgctgatatagcagtagacctatttgctgaactgcaagaa
gtagatccatatagactggaacatatggatatatattccaaccttctctatgtcaaggaa
atgaagcctgaactcggttatcttgcccataaatgttgtgaaattgacaagtatagagtg
gaaacatgttgtgttatcggtaatttctacagtctgagatcacagcatgaaaaggcagcg
ctttacttccagagatctctgaaactaaacccacattacctggcagcgtggacattgatg
ggacatgaatacatggaaatgaagaacacatctgccgctatacaggcttatagacaagct
attgaggtcaatcgtcgtgattatcgtgcgtggtatggtctcgggcaaacatatgaaatt
ctgaaaatgcctttctactgtctgtattattacaagcaagcacagaaactcagacccaac
gattcaagaatgttggttgctttgggcgaatctctcgagaaattggaacgaattcaagct
gctaagaaatgttactggagagcgtactccgtgggtgatgtcgagggacaggcgctgatt
aaactagctaagttgcatgaaaacttgaaagaagaagaacaagctgccacattttatgcc
aaatttgttgaacagtcagaagtaatgggaactgtggaaactgaagaacgatgtcatgca
tattatttcttagctgattattacatgaaacaaggcagttatgaagaagcaagtagttat
gctcacaagtgctgtgcatacaatgagacgaaggaaaatggaaaagctattctaagacaa
atagcaaaccttagggtcacatctgaggtctctaaacccgatgatagcccctcggaacat
tgtatgaaagtatccaatgagaacacaccaatgagaacaggaatatcacccatggattta
acattcacaccatag

DBGET integrated database retrieval system