KEGG   Serpula lacrymans: SERLADRAFT_433295Help
Entry
SERLADRAFT_433295 CDS       T03135                                 

Definition
(RefSeq) hypothetical protein
  KO
K11405  
histone deacetylase 8 [EC:3.5.1.98]
Organism
sla  Serpula lacrymans
Brite
Enzymes [BR:sla01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     SERLADRAFT_433295
Chromosome [BR:sla03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     SERLADRAFT_433295
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 421 aa AA seqDB search
MATSKKTNNPNKRVVYVVSEELAKVSSLLPSNKNRSLLVHSLASSLGILVPKQKHNGQHI
RLIRPNRATLKDLSVYHTRDYLDFSLNPDNHSENVQQEPNESADFGLEDDCPPFRGLDDY
IFLVAGASLTGANTLKTDQADIAICWDGGRHHAQKARASGFCYVADCVLAILALRRFVPN
PYDNISPAPPSKKPRIMYLDLDLHFSDSVSQAFYSTSSTNSPQVLTFSIHHAAEGFFPIS
PLSSLPAPGSPTFDPFSLSLPLRPGASNRTFMRIWPIVERVKNLFEPDYIVVQCGLDGLA
GDPMATWNWSLEGEGSLGWCTSRVVHEWDGKKLLLGGGGYNSPNAARAWAYLTSIAMGKP
LSVDTEIPDHRAFPLYGPSFTLDVPAGNMQDQNNEEYIKSVEECFEDVLFALQHRLRQST
T
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggcgacctcaaaaaaaaccaacaaccctaataaacgtgtggtgtacgttgtttcagag
gagctggccaaggtttcatctctacttccatcgaacaagaacagatctctgctggttcac
tccctcgcaagctctctcggtatactagtaccaaagcaaaagcacaatgggcagcatata
cgcctcattcgaccaaatcgcgccactctcaaggatctgtccgtctatcacacccgcgac
tacctggacttctctttgaaccccgataaccactctgaaaacgttcaacaggaaccaaat
gaaagtgcagatttcggtcttgaagatgattgcccaccttttcgcggattagacgactac
atatttctcgtagcaggcgcttctctgacaggagcaaacactcttaagaccgatcaagct
gatatcgcaatatgctgggacggcggcaggcatcatgctcagaaagctcgcgcgtccggg
ttctgctacgtcgccgactgcgtcctcgccatcctcgctctgaggcggttcgtcccaaat
ccctacgacaatatctcacctgctcctccgtctaaaaagcctcgcatcatgtatctagac
ctcgatctgcatttctccgattctgtttcgcaagctttctattctaccagctctaccaac
agtccacaagttcttactttttctattcaccatgctgctgaagggttcttccccatctct
ccactatcgagtctccccgcaccaggatctcccacctttgaccctttctctctttccctc
cctctcagaccgggagcttcgaaccgcacctttatgcgaatatggccaatagtagaacgc
gttaagaacctatttgagcctgactacatcgtcgtgcaatgtggcttggacggtctagct
ggagatccaatggccacctggaactggtctttagaaggggaaggctctctaggctggtgt
accagtcgcgtagtacacgaatgggacggtaaaaaactactactcggtggaggcggctat
aactctcccaacgccgcccgtgcatgggcgtatctgacatcgatcgccatgggaaagcca
ctctcagtagatacagaaataccggatcatcgcgcgttcccgctatacggcccatctttc
acgctggatgttcccgcaggcaatatgcaggatcagaataacgaagagtacatcaaatct
gtcgaagagtgttttgaagatgtattgttcgccctacaacatcgcctacgccagtctacc
acctag

DBGET integrated database retrieval system