KEGG   Serpula lacrymans: SERLADRAFT_458070Help
Entry
SERLADRAFT_458070 CDS       T03135                                 

Definition
(RefSeq) hypothetical protein
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
sla  Serpula lacrymans
Pathway
sla00250  Alanine, aspartate and glutamate metabolism
sla00410  beta-Alanine metabolism
sla00430  Taurine and hypotaurine metabolism
sla00650  Butanoate metabolism
sla01100  Metabolic pathways
sla01110  Biosynthesis of secondary metabolites
Module
sla_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:sla00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    SERLADRAFT_458070
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SERLADRAFT_458070
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SERLADRAFT_458070
   00430 Taurine and hypotaurine metabolism
    SERLADRAFT_458070
Enzymes [BR:sla01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     SERLADRAFT_458070
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-GeneID: 18817639
NCBI-ProteinID: XP_007314037
JGI: 458070
UniProt: F8NIN3
LinkDB All DBs
Position
Unknown
AA seq 541 aa AA seqDB search
MALSKHVNPDRLIQESRDKKNHHHSLTKSDPNKVTHPYGARYGTASIPKFHIPSKGTDAQ
SAYQLIHDELSLDGSPSLNLASFVHTWMPDPANKLMMENMSKNLIDQDEYPMTQLIHTRC
INILADLWHAPHSHEAVGTATTGSSEAIQLGGLAMKRIWQEKRKAAGKSIHEPGPNIVMG
ANAQVALEKFARYFEVECRLVPVSVESKYRLDPKKAMEYVDENTIGVYVILGSTYTGHYE
PVKEMSDLLDEYEKQSGINVPIHVDGASGAFVAPFASPKLLWDFKLPRVISINTSGHKFG
LAYVGVGFVIWRSKQYLPKDLIFELHYLGSVEYSFSLNFSRPAAPIIAQYFNFLHLGFEG
YRAVALDDLKNARVLSRALERTGWYTVLSDIHRVKDAGLLAKGAKQAIGFDEENAEEDGL
PVVSFRFSDDFQAKYADIQQKWIQTLLRSKGWIVPNYELAPDLEHVQILRVVVRENMSEA
LVDRLVADIVEITEDLTKRASSTHALDLLGSHSQSTSAKSHEGKMEEGSASEYSGTYAKT
C
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atggctctctcaaagcatgtcaatcccgacagactcattcaggaatcaagagacaaaaaa
aatcatcaccatagtcttacgaaaagtgacccaaacaaagtgacccatccgtatggtgcc
cgctacggaacggcctccattccaaagttccacattccttccaaaggcacagatgcccaa
tccgcgtaccagctcattcatgacgagctcagtctcgatggatctcccagtctcaacctt
gcgtccttcgttcacacatggatgcctgatcctgctaacaaactcatgatggaaaatatg
tccaaaaatttgattgaccaggacgaatatcccatgacccaactcattcacactcgctgc
attaacattctcgctgatctgtggcatgcgccacatagccatgaggccgtagggactgcc
acaacaggctcctctgaagcaatacaactcggaggtctcgccatgaagcgtatctggcaa
gagaaacgaaaagctgctggaaagtctatccatgaacccggcccaaacattgtcatgggg
gctaatgctcaggtcgcccttgagaaatttgctcgctatttcgaggtagagtgtcgcctg
gtccctgtgagcgtcgagagcaagtacaggctcgaccctaaaaaagcaatggaatatgtc
gatgagaacacaattggtgtctacgttatcctcgggagcacgtacactggtcattacgaa
cctgttaaggagatgtccgaccttttggatgaatacgagaaacaatcgggtattaatgta
cccattcacgttgatggtgcttcaggcgcatttgtcgcaccatttgcgtcacccaagctg
ctttgggactttaagcttcctcgtgtcatatctatcaacacatcgggacataaattcggt
cttgcgtatgttggtgtcggatttgtaatatggcggtcaaaacaatacctgcctaaagac
ctcatcttcgagctgcattaccttgggtctgtggaatattctttttcactgaacttctcc
aggcccgccgcaccgatcattgcgcagtacttcaatttcttgcacctaggattcgaaggc
taccgtgcagtagcgttggacgaccttaagaatgcccgtgtattgagtcgtgccctggaa
aggaccgggtggtacacggtcttgagtgacattcacagagtgaaagacgcgggtttgctg
gcgaagggagcgaagcaagctataggatttgacgaggagaacgcggaggaggatgggctg
ccagtcgtctcgttccgcttctcggacgatttccaagctaagtatgctgacatacagcaa
aagtggatccagacgctcttacgttctaaaggatggattgtcccaaattatgagcttgca
cccgaccttgaacatgtacagatcttgcgtgtggtagttagagagaatatgtccgaggct
cttgttgatcggctcgtggcagacatcgttgaaattactgaagatctaaccaaacgtgca
tcgtccacgcatgctcttgacttacttgggtcacacagtcaaagcacatctgcgaaatct
catgaaggaaaaatggaagaaggttctgcgtcagagtattctggtacctacgccaaaacc
tgttag

DBGET integrated database retrieval system