KEGG   Streptomyces lydicus: SL103_20375Help
Entry
SL103_20375       CDS       T04699                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
slc  Streptomyces lydicus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
4699541..4700608
Genome map
AA seq 355 aa AA seqDB search
MDLPVMPPVSPMLAKLVPEIPAGMQYEAKWDGFRVIVFRDGDEVEITSRTTKPLTRYFPE
VIAAAREQLPARCVVDGEIVIAHDGRLHFEELLERIHPADSRVRTLAARTPASLVAFDLL
ALDTRALTAEPQSARREALVEALRPARPPVYTAPATTDQELARHWFTQFEGAGLDGVVAK
PLHLPYRPGDRALYKIKHARTADCVVAGYRLHKSGPVVGSLLLGLHDAEGQLQHVGVCAS
FPMARRRALVEELEPLRLDDVTEHPWGAWTDEAAHASRRMPGGPSRWSGGKDLSWVPLRP
ERVCEVAYDHMEGDRFRHTAQFRHWRPDRTPESCTYDQLEEPVGYDLGELLHDDR
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atggacctgcccgtcatgcccccggtctccccgatgctcgcgaagctggtgccggagatc
cccgccggcatgcagtacgaggccaaatgggacggcttccgggtgatcgtcttccgggac
ggcgacgaggtcgagatcaccagccggaccacgaagccgctcacccggtacttccccgag
gtgatcgcggcggcgcgggaacagctgccggcgcgctgtgtcgtcgacggggagatcgtc
atcgcccacgacgggcggctgcacttcgaggagctgctggagcgcatccaccccgcggac
tcccgggtccgtaccctcgccgcgcgcacccccgcctccctcgtcgccttcgacctgctg
gccctggacacccgggcactgaccgccgaaccgcagtcggcgcgcagggaggcgctggtc
gaggcgttgcggccggcccggccaccggtgtacacggcgcccgcgacgacggaccaggaa
ctggcgcgccactggttcacccagttcgagggtgccgggctggacggggtggtggccaag
ccgctccatctgccgtaccggcccggcgaccgggccctgtacaagatcaagcatgcccgg
accgcggactgtgtcgtcgccggctaccggctgcacaagagcggcccggtggtcggctcc
ctgctgctgggcctgcacgacgccgaggggcagctccagcatgtcggcgtgtgcgcctcc
ttccccatggccaggcggcgcgcgctggtcgaggagctggagccgctgcggctggacgac
gtcacggagcacccgtggggggcgtggacggacgaggcggcgcacgcgtcgcggcggatg
cccggcgggcccagccggtggagcggcggcaaggacctgtcgtgggtgccgctgcggccg
gagcgggtgtgcgaggtcgcctacgaccacatggagggcgacaggttccggcacaccgcg
cagttccgccactggcggcccgaccgtacgccggagagctgcacctacgaccagctggag
gagccggtgggctacgacctgggagaactgctgcacgacgaccgatga

DBGET integrated database retrieval system