KEGG   Streptomyces sp. A02: T261_0463Help
Entry
T261_0463         CDS       T03756                                 

Definition
(GenBank) DNA ligase C
Organism
sld  Streptomyces sp. A02
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
493306..494367
Genome map
AA seq 353 aa AA seqDB search
MDLPVMPPVSPMLAKLVADIPAGMQYEAKWDGFRVIVFRDGDEVEITSRTTKPLTRYFPE
TVAAVRRELPPRCVVDGEIVIAHDGRLHFEELLERIHPADSRVRTLAERTPASLVAFDLL
ALGPDSLLDEPQSARREALVEALRPARAPVYTAPATTDQELARTWFDRFEGAGLDGVVAK
PLHLPYRPGDRAMFKIKHARTADCVVAGYRLHKSGPVVGSLLLGLHDDAGRLQHVGVCAS
FPMAKRRKLVEELAPLRMDDAAGHPWGEWTDEAAHASRRMPGGPSRWSGGKDLSWVPLRP
EWVCEVAYDHMEGSRFRHTAQFRRWRPDRTPESCTYAQLEEPVGYDLGELLNG
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atggacctgcccgtcatgcccccggtctccccgatgctcgccaagctcgtggccgacatc
cccgcgggcatgcagtacgaggccaaatgggacggcttccgcgtcatcgtcttccgggac
ggcgacgaggtcgagatcaccagccgtacgacgaagccgctcacccgctatttccccgag
accgtcgccgccgtacgccgtgagctgccgccgcgctgcgtcgtcgacggcgagatcgtc
atcgcgcacgacgggcggctgcacttcgaggagctgctggaacgcatccatcccgccgac
tcccgggtccgtacgctcgccgagcggacacccgcctccctcgtcgccttcgacctgctg
gccctgggcccggattcgctgctggacgagccgcagtcggcgcggcgggaagcgctggtc
gaggcgctgcggccggcccgcgcgccggtgtacaccgcgcccgcgaccaccgatcaggag
ctggcccgcacctggttcgaccggttcgagggggcgggcctggacggggtggtcgccaag
ccgctgcatctgccgtaccggccgggcgaccgggcgatgttcaagatcaagcacgcccgc
acggccgactgcgtcgtcgcggggtaccggctgcacaagagcggaccggtggtcggctcc
ctgctgctgggcctgcacgacgacgccgggcggctgcagcacgtcggggtgtgcgcctcg
ttcccgatggcgaagcggcgcaagctcgtcgaggagctcgcaccgctgcggatggacgat
gccgccgggcacccctggggggagtggacggacgaggcggcgcacgcctcccggcggatg
ccgggcgggcccagccggtggagcggtggcaaggatctgtcgtgggtgccgctgcgcccg
gagtgggtgtgcgaggtcgcgtacgaccacatggagggcagccggttccggcacaccgcg
cagttccgcagatggcggcccgaccgtacgccggagagctgcacatatgcgcagctggag
gagccggtcggctatgacctgggggaactgctgaacggctga

DBGET integrated database retrieval system