KEGG   Streptomyces sp. A02: T261_1781Help
Entry
T261_1781         CDS       T03756                                 

Definition
(GenBank) hypothetical protein
  KO
K00823  
4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
sld  Streptomyces sp. A02
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:sld00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    T261_1781
   00650 Butanoate metabolism
    T261_1781
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    T261_1781
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    T261_1781
Enzymes [BR:sld01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     T261_1781
Amino acid related enzymes [BR:sld01007]
 Aminotransferase (transaminase)
  Class III
   T261_1781
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1886934..1888247)
Genome map
AA seq 437 aa AA seqDB search
MTHDSAGLYARHRAVLPSWLSLYYERPLELTHGEGRYVWDAEGNRYLDFFGGILTTMTAH
ALPEVTKAVGEQAGRIIHTSTLYLSRPMVELAERIAALSGIPDARVFFTTSGTEATDTAL
LLATSYRRSNQVLAMRNSYHGRSFSAVGITGNQSWSPTSLSPLQTLYVHGGVRSRGPYAR
LSDADYIKACVADLEDVLQQTAGGVAALIAEPVQGVGGFTAPPDGLYAAFREVLAREGIL
WISDEVQTGWGRTGDHFWGWQAHADNGPPDLLTFAKGIGNGMSIGGVVARADVMNSLSAN
SISTFGGSPVTMAAGLANLTYLLEHDLQGNARRVGGLLIERLRAISAGLEVVREVRGRGL
MIGVELVRPGTDEPSAEAASLVIEAARERGLLVGKGGHGGATLRIAPPMTLTVAEAEEGA
ELLAEALRAAQGRLVGS
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
gtgacccacgactccgcgggcctgtacgcccgccaccgcgccgtcctgccgtcctggctg
agcctctactacgagcggccgctcgaactcacccacggcgagggccgctacgtctgggac
gccgagggcaaccgctacctcgacttcttcggcggcatcctcaccaccatgaccgcccac
gccctgcccgaggtgaccaaggcggtcggcgaacaggccggccgcatcatccacacctcc
acgctctacctgtcccgccccatggtggaactggccgaacggatcgcggcactctccgga
atccccgacgcccgggtcttcttcaccacctccggtaccgaagccaccgacacggccctg
ctgctggccacgtcgtaccgccgctccaaccaggtcctggcgatgcgcaacagctaccac
ggccggtccttctccgccgtcggcatcaccggcaaccagagctggtcgcccaccagcctc
tcgcccctccagacgctgtacgtacacggcggggtgcgcagccgcggcccgtacgcccgt
ctctccgacgccgactacatcaaggcctgcgtcgccgacctcgaggacgtgctccagcag
accgcgggcggcgtcgcggcgctgatcgccgaacccgtccagggggtcggcggcttcacc
gcgcccccggacggcctctacgccgccttccgcgaggttctcgcccgcgagggcatcctc
tggatcagcgacgaggtgcagaccggctggggccgcacgggagaccacttctggggctgg
caggcgcacgccgacaacggcccgccggacctgctcaccttcgccaagggcatcggcaac
ggcatgtccatcggcggcgtcgtcgcccgtgcggacgtgatgaactccctctccgcgaac
tccatttccaccttcggcggcagccccgtcaccatggccgccggcctcgccaatctcacc
tacctcctcgaacacgacctccagggcaacgcccggcgcgtcggcggcctgctcatcgag
cggctgcgggcgatctcggccggactcgaggtggtacgcgaggtgcgcggccgcggcctg
atgatcggcgtcgagctggtgcgccccggtacggacgagccctccgccgaggccgcgtcc
ctggtcatcgaggccgcccgggaacgcgggctgctggtgggcaagggcggtcacggcggc
gccacgctgcggatcgcacccccgatgacgctcaccgtcgcggaggcggaggagggggcg
gagctgctcgccgaggcgctgcgggcggcgcaggggaggctggtgggttcgtag

DBGET integrated database retrieval system