KEGG   Streptomyces sp. A02: T261_3726Help
Entry
T261_3726         CDS       T03756                                 

Definition
(GenBank) Glutamate decarboxylase
  KO
K01580  
glutamate decarboxylase [EC:4.1.1.15]
Organism
sld  Streptomyces sp. A02
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Taurine and hypotaurine metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Quorum sensing
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:sld00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    T261_3726
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    T261_3726
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    T261_3726
   00430 Taurine and hypotaurine metabolism
    T261_3726
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    T261_3726
Enzymes [BR:sld01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     T261_3726
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
4004079..4005497
Genome map
AA seq 472 aa AA seqDB search
MTLHKGSPDGDRRAEARRPVNPFYGDADPVAGFASSPPRHALPDGPVSPQTAYQFVHDEL
MLDGNARLNLATFVTTWMEPQAGVLMAECRDKNMIDKDEYPRTAELEKRCVAMLADLWHA
PDPSSTVGCSTTGSSEACMLAGMALKRRWMQRNGDRYPGAARPNLVMGANVQVCWEKFCN
FWEVEMRLVPMEGDRFHLDAGTAVGLCDENTIGVVAVLGSTFDGSYEPVAGICAALDEMQ
ERTGWDVPVHVDGASGAMIAPFLDPDLVWDFRLPRVASINTSGHKYGLVYPGVGWALWRD
QEALPEELVFRVNYLGGDMPTFALNFSRPGAQVAAQYYTFLRLGRAGYRAVQQATRDVAR
TMAERIGALGDFRLLTRGDELPVFAFTTADEVKAFDVFDVSRRMRERGWLIPAYTFPPHR
EDLSVLRIVCRNGFSHDLAEMFLGDLEQLLPELRDQPGPLQRPEGVATAFHH
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgacgctgcacaaggggtcacccgacggcgaccggcgagcggaggcccgccgcccggtc
aaccccttctacggggacgccgacccggtcgccggttttgcctcctctcccccgcggcat
gcgctgcccgacggcccggtctccccgcagaccgcctaccagttcgtgcacgacgagctg
atgctcgacggtaatgcgcggctgaatctggcgaccttcgtcaccacctggatggaaccg
caggccggcgtcctgatggccgagtgccgggacaagaacatgatcgacaaggacgagtac
ccgcgcaccgcggagctggagaagcggtgtgtggcgatgctcgccgacctgtggcacgcg
cccgacccgtcgtcgaccgtcggctgttcgaccaccgggtcgagcgaggcgtgcatgctg
gccgggatggccctgaagcggcgctggatgcagcggaacggcgaccggtatccgggggcg
gcccggcccaacctggtcatgggggccaacgtccaggtctgctgggagaagttctgcaat
ttctgggaggtggagatgcgccttgtcccgatggagggcgaccgcttccacctggacgcg
ggaacggccgtcggcctctgcgacgagaacaccatcggtgtcgtcgccgtcctcggctcg
accttcgacgggtcgtacgagccggtggccggcatctgcgcggcgctggacgagatgcag
gaacggacgggctgggacgtcccggtgcacgtggacggcgcgtccggtgccatgatcgcg
ccgttcctcgacccggacctggtgtgggacttccggctgccccgcgtcgcctccatcaac
acctccgggcacaagtacggcctggtctaccccggcgtcggctgggcgctgtggcgcgac
caggaagcgctgcccgaggagctggtcttccgggtcaactacctgggcggcgacatgccg
accttcgccctcaacttctcccgccccggtgcccaggtcgccgcccagtactacaccttc
ctgcggctgggccgggccggttaccgcgccgtacagcaggcgacccgcgacgtggcccgc
accatggccgaacggatcggtgcgctgggcgacttccgcctcctgacccgcggcgacgag
ctgccggtcttcgccttcacgaccgcggacgaggtgaaggccttcgacgtcttcgacgtg
tcgcgcaggatgagggagcgcggctggctgatccccgcctacaccttcccgccgcaccgc
gaggacctctccgtcctgcgcatcgtctgccgcaacggcttctcccacgacctcgcggag
atgttcctcggcgacctggaacaactcctgcccgaactgcgcgaccagcccggcccgttg
cagcggccggaaggcgtggcgacggccttccaccactga

DBGET integrated database retrieval system