KEGG   Streptomyces sp. A02: T261_4708Help
Entry
T261_4708         CDS       T03756                                 

Definition
(GenBank) Alanine racemase
  KO
K01775  
alanine racemase [EC:5.1.1.1]
Organism
sld  Streptomyces sp. A02
Pathway
D-Alanine metabolism
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sld00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    T261_4708
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    T261_4708
Enzymes [BR:sld01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     T261_4708
Peptidoglycan biosynthesis and degradation proteins [BR:sld01011]
 Precursor biosynthesis
  Racemase
   T261_4708
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
4999034..5000254
Genome map
AA seq 406 aa AA seqDB search
MNETAKRARATIDVAAVRSNVRALRDRAPRAELMAVVKADGYGHGAVPCARAARQAGASW
LGTALPEEAFALRAAGDTGRLLCWLWTPGGPWGKAVEQDIDVSVSGLWALREVTEAARAC
GRPARVQLKADTGLGRNGCQPADWPELTAAAAKAEADGAVKVTGLWSHFACADEPGHPSI
PLQTAAFEEALEVAGAAGLRPEVRHIANTAALLTLPDAHYDLVRGGIGIYGVSPSPELGT
PHDFGLRPAMTLEASLASVKRAPGGHGVSYGHHYTTAGDTTLALIPLGYADGIPRNASGR
GPVLVAGRRRTVAGRIAMDQFVVDLDGDRAGAGDPAVLFGPGDRGEPLAEDWAEAAGTIG
YEIVTRIGTRVPRVYVDTDAGKGGVVTTGAEDTGGEADPTRTGGGR
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagacagcgaagcgggcccgcgccacgatcgacgtcgccgccgtgcggtcgaat
gtgcgcgcgttgcgagaccgcgcaccccgggcagagctgatggccgtggtcaaggccgac
ggctatggacacggcgcggtgccctgcgcccgcgccgcccgccaggccggtgcgagctgg
ctgggcacggcgctgcccgaggaggcgttcgcgctgcgcgcggccggcgacaccgggcgg
ctgctgtgctggctgtggacgccgggcggcccctggggcaaggccgtcgagcaggacatc
gacgtctcggtgagcgggctgtgggcgctgcgcgaggtgaccgaggcggcccgcgcgtgc
gggcgcccggcccgggtccagctcaaggccgacaccggtctcggccgcaacggctgccag
cccgccgactggccggaactcaccgcggcggccgccaaggccgaggccgacggcgccgtc
aaggtcaccggcctgtggtcgcacttcgcctgcgccgacgagcccggacacccctccatc
ccgctccagacggccgccttcgaggaggcgctggaggtcgccggggccgccggactgcgc
cccgaggtgcggcatatcgccaacaccgcggcgctgctcaccctccccgacgcgcactac
gacctggtacgcggtggtatcggcatctacggcgtgtcgcccagccccgagctcggcacg
ccccacgacttcggactgcggccggcgatgaccctggaggcgtcgctggcgtccgtcaaa
cgggccccgggcggccacggcgtgtcgtacgggcaccactacaccacggccggtgacacc
accctcgcgctgatcccgctcggctacgccgacggcatcccgcggaacgcctccggccgc
ggcccggtgctggtggcgggcaggcggcggacggtcgccgggcggatcgcgatggatcag
ttcgtggtcgatctcgacggggaccgcgcgggggcgggggatccggcggtgctgttcggg
cccggcgaccgcggcgagcccctcgcggaggactgggccgaggcggccggaaccatcggg
tacgaaatcgtcacaaggatcgggacgagagtgccgcgcgtctatgtggatacggatgct
gggaaaggtggcgtcgtgaccaccggtgccgaggacaccggtggtgaagcggatccgact
cgtacggggggtgggcgatga

DBGET integrated database retrieval system