KEGG   Streptomyces leeuwenhoekii: sle_05330Help
Entry
sle_05330         CDS       T04414                                 

Gene name
sle_05330
Definition
(GenBank) Beta-galactosidase
  KO
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
sle  Streptomyces leeuwenhoekii
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sle00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    sle_05330 (sle_05330)
  Lipid metabolism
   00600 Sphingolipid metabolism
    sle_05330 (sle_05330)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    sle_05330 (sle_05330)
Enzymes [BR:sle01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     sle_05330 (sle_05330)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
chromosome:complement(592918..596019)
Genome map
AA seq 1033 aa AA seqDB search
MTVTRRSVLAASAAAPAAGALLGTPAARAADVTGDAPGRRAVALRDGWRFALVNPGGITD
PTGRYAQAADPGYDDAAWRRVAVPHDWSIEQTPTTGHGTTSGTGFLPGGLGWYRLAFTLP
SAYAGKRISVEFDGVYMDAYVYCNGREIGRHPYGYTGFALDLTEVVHTDGRTPNVLAVKV
QNRLPSSRWYSGSGIYREARLVVTEPVHVARWGTYVTTPQVEDDRAVVRARTTVVNTSGA
SRQVEIRSVIRDADGRTVARAVSTAPVAAAGEHTETHQLTVPRPRLWDFATPHRYTLRTE
LRVGGRSVDTYDTPFGIRTFHVDPEEGFHLNGAYTKIKGVDLHHDLGALGAAVSTDAIRR
QMDIMKSMGVNALRTSHNPPAPELIRVCEELGIVMLVEAFDCWRTGKNPYDYGRFFDEWC
ERDTTEMVCAARNSPAVVMWSIGNEVPDSTTTAGLAMADRIIDAIRAADDTRPLVIGSDK
YRRLPAKGSPADLMLAKLDGLGLNYNTAKSVDALHQAYPHLFLFESESSSETSTRGTYQE
PERLNTGENHTPGRRATSSYDNNLASWTMSGEYGHKKDRDRKWFAGQFLWSGIDYIGEPT
PYDVFPVKASFFGAVDTAGFPKDMYHLFRSQWTDEPMVHLLPMTWNHEEGDTVEVWAYAN
VATVELFLNGRSLGTRSFDTKTTVDGRAYLETTEATGDDKTFTDGPYPGSYTSPNGSAGK
LHLTWKVPFEPGGLRAVARRDGEVVATDVLRTAGAAHAIRLTPDRASAAADGRSLVFVTA
EVVDRHGVVVPDAGHPLSFEVTGGSLAGVDNGRQESAERYQASTRTAFHGKALAIVRAGT
RAGTLRVTARADGLRTGTAAVRTTRAASPATTPAPDFAPDHPAPRTYPYADAGYSGRPDT
LPAAMLDGDPATGWSNGFLKAATPLLPAFDGARAEDWVSVDYGRTRAFDRLEVSFTVDGG
HSLPAAAEVAVFDGRGWRAVEGARVEWATASDTPTVITFDRVRGSRLRLTLTSRHPGRPQ
GAVRISRWEAPAA
NT seq 3102 nt NT seq  +upstreamnt  +downstreamnt
atgacagtcacgcgcagatcggtcctcgccgcctccgcggccgccccggcggccggagcg
ctcctgggcaccccggcggcccgggccgcggacgtgacgggcgacgcccccggccgccgg
gccgtcgccctgcgcgacggctggcgcttcgcgctggtgaacccgggcgggatcaccgac
ccgacgggccggtacgcgcaggccgccgacccggggtacgacgacgcggcgtggcggcgg
gtggccgtgccgcacgactggagcatcgagcagacgcccacgaccgggcacggcacgacc
agcggcaccgggttcctccccggcggcctcggctggtaccgcctggccttcaccctgccg
tccgcgtacgccggcaagcggatctcggtcgagttcgacggcgtctacatggacgcgtac
gtgtactgcaacggccgggagatcggccggcacccctacggctacacgggcttcgccctc
gacctcaccgaggtggtgcacaccgacggccgcacgcccaacgtcctcgcggtcaaagtg
cagaaccggctgcccagcagccgctggtactccggcagcggcatctaccgcgaggcccgc
ctggtcgtcaccgagccggtgcacgtggcgcgctggggaacgtatgtgacgacccctcag
gttgaggacgaccgggccgtggtgcgggcccgcaccacggtcgtgaacacctcgggggcc
tcccggcaggtcgagatacggtcggtgatccgggacgcggacgggcgcacggtggcccgc
gccgtctccacggccccggtcgcggcggccggcgaacacaccgagacccatcaactgacc
gtcccccgcccccgtctgtgggacttcgccaccccgcaccgctacaccctgaggaccgaa
ctgcgcgtcggcggccggagcgtcgacacctacgacacgcccttcggcatccgcaccttc
cacgtcgaccccgaggagggcttccacctcaacggcgcctacaccaagatcaagggggtc
gacctccaccacgacctgggggcgctgggcgccgccgtcagcaccgacgcgatccgccgg
cagatggacatcatgaagtccatgggcgtcaacgccctgcgcacctcgcacaatccgccc
gcgcccgaactgatccgcgtctgcgaggaactgggcatcgtgatgctggtggaggcgttc
gactgctggcggaccggcaagaatccctacgactacggccggttcttcgacgagtggtgc
gagagggacaccaccgagatggtgtgcgcggcccgcaactcgcccgccgtggtgatgtgg
tccatcggcaacgaggtccccgactccaccaccaccgccgggctcgccatggccgaccgg
atcatcgacgcgatccgggccgccgacgacacccgtcctctcgtcatcggctccgacaag
taccgccgcctgcccgccaagggctcgcccgccgacctgatgctggccaagctggacggc
ctcggcctcaactacaacaccgccaagtcggtggacgccctgcaccaggcgtatccccat
ctgttcctcttcgagtcggagtcgtcctcggagacctccacccgcggcacctaccaggag
cccgagcgcctcaacaccggcgagaaccacacgccgggcaggcgtgcgacctcctcctac
gacaacaacctcgcctcctggaccatgagcggcgagtacggccacaagaaggaccgcgac
cgcaagtggttcgccgggcagttcctgtggtcgggcatcgactacatcggggagcccacg
ccctacgacgtcttcccggtgaaggcctccttcttcggcgcggtcgacaccgccggattc
cccaaggacatgtaccacctcttccgcagccagtggaccgacgagccgatggtccacctg
ctgcccatgacctggaaccacgaggagggcgacacggtcgaggtgtgggcgtacgcgaac
gtcgccaccgtggagctcttcctcaacggcaggtccctcgggacgcggagcttcgacacc
aagacgaccgtcgacggccgcgcctacctggagaccaccgaggcgaccggcgacgacaag
accttcaccgacggcccctacccggggagctacaccagccccaacggcagcgcgggcaag
ctccatctgacctggaaggtgcccttcgaaccgggcgggctcagggccgtggcccggcgg
gacggcgaggtggtcgccaccgacgtcctgcgcaccgccggggcggcgcacgcgatccgg
ctgacaccggaccgcgcctcggccgccgcggacggccgctccctggtgttcgtgaccgcc
gaggtggtcgaccggcacggcgtggtggtgcccgacgccgggcatccgctctccttcgag
gtcaccggcggatccctggccggagtcgacaacggccgccaggagagcgccgaacgctac
caggcgagcacccgcaccgccttccacggcaaggcgctggccatcgtccgcgccggcacc
cgggccgggacgctccgggtgaccgcccgggccgacgggctgcgcaccggcacggccgcc
gtgcggaccacccgggcggcctcccccgcgaccacgcccgcgcccgacttcgcgccggac
caccccgcgccgcggacgtacccgtacgcggacgccggttactccggccgccccgacacc
ctgcccgccgccatgctcgacggcgacccggccaccggctggtccaacggcttcctcaag
gcggccacccccctgctgcccgccttcgacggggcccgcgccgaggactgggtctcggtc
gactacgggcggacgcgggccttcgaccgtctggaggtctccttcaccgtcgacggcggg
cacagcctgccggccgcggccgaggtcgccgtcttcgacggccgcggatggcgggcggtc
gagggcgcccgcgtcgagtgggccaccgcctccgacacgcccaccgtcatcaccttcgac
cgggtccggggttcccggctgcgtctgacgctgacgagccgtcacccgggccggccgcag
ggggcggtgcgtatcagccggtgggaggcgcccgccgcctga

DBGET integrated database retrieval system