KEGG   Streptomyces leeuwenhoekii: sle_13620Help
Entry
sle_13620         CDS       T04414                                 

Gene name
sle_13620
Definition
(GenBank) Acetylornithine aminotransferase
  KO
K00823  
4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
sle  Streptomyces leeuwenhoekii
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sle00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    sle_13620 (sle_13620)
   00650 Butanoate metabolism
    sle_13620 (sle_13620)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    sle_13620 (sle_13620)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    sle_13620 (sle_13620)
Enzymes [BR:sle01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     sle_13620 (sle_13620)
Amino acid related enzymes [BR:sle01007]
 Aminotransferase (transaminase)
  Class III
   sle_13620 (sle_13620)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
chromosome:complement(1690182..1691468)
Genome map
AA seq 428 aa AA seqDB search
MTRDLLSRHRAVLPDWLALYYEDPVEITHGEGRHVWDAAGNRYLDFFGGILTTMTAHALP
EVTKAVSEQAGRLLHSSTLYLNRPMVELAERVAHLSGIPDARVFFTTSGTEANDTALLLA
TTYRRSNTVLAMRNSYHGRSFGAVGITGNRGWSPTSLSPLQTLYVHGGVRTRGPYAALGD
REFIDACVADLVDLLGHTRPPAALIAEPVQGVGGFTSPPDGLYAAFREVLRERGILWIAD
EVQTGWGRTGDHFWGWQAHARSGPPDIVTFAKGIGNGMSIGGVIARAEIMNCLDANSIST
FGGTQVTMAAGLANLTYLLEHDLQGNARRVGGLLIERLRSVAAQVPHVREVRGRGLMIGI
ELTRPGTDEADWQAASAVLEAARAGGLLIGKGGGHDTSALRIAPPLSLTVAEAEEGAAIL
ERALRSLE
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
gtgacccgcgacctgctgagccgccaccgcgccgtcctgcccgactggctcgccctctac
tacgaggacccggtcgagatcacccacggcgagggccgccacgtctgggacgccgccggc
aacaggtacctggacttcttcggcggcatcctcaccaccatgaccgcccacgccctgccc
gaggtgaccaaggcggtgagcgagcaggccgggcggctcctgcactcctcgaccctctat
ctcaaccgccccatggtcgaactggccgaacgcgtcgcccacctgtccggcatccccgac
gcccgggtcttcttcaccacctccggcaccgaggccaacgacaccgccctgctgctggcg
acgacgtaccggcgcagcaacaccgtcctcgcgatgcgcaacagctaccacggccgctcc
ttcggcgcggtcggcatcaccggcaaccgcggctggtccccgacgtcgctgtccccgctc
cagacgctgtacgtgcacggcggcgtgcgcacgcgcgggccctacgccgcgctcggcgac
cgggagttcatcgacgcctgtgtcgcggacctcgtcgacctgctcggccacacccgcccg
ccggccgccctgatcgccgaacccgtccagggcgtcggcggcttcacctccccgccggac
ggcctctacgccgccttccgggaggtgctgcgcgagcgcggcatcctgtggatcgccgac
gaggtgcagaccggctggggccgcaccggcgaccacttctggggctggcaggcccacgcc
cgcagcggcccgcccgacatcgtcaccttcgccaagggcatcggcaacggcatgtccatc
ggcggggtgatcgcccgcgccgagatcatgaactgcctggacgccaacagcatctccacc
ttcggcggcacccaggtcacgatggcggccggcctcgccaatctgacgtacctgctggaa
cacgacctccagggcaacgcccggcgggtcggcgggctgctcatcgagcggctgcggtcc
gtcgccgcccaggtgccgcacgtgcgggaggtgcgcgggcggggactgatgatcggcatc
gaactgacccgccccggcaccgacgaggcggactggcaggccgcgtccgccgtgctggag
gcggcccgcgcgggcggcctgctcatcggcaagggcggcggacacgacaccagcgccctg
cgcatcgccccgccgctgtccctcacggtcgcggaggcggaagagggcgccgcgatcctg
gagcgcgccctgagaagcctcgagtag

DBGET integrated database retrieval system