KEGG   Spirosoma linguale: Slin_5027Help
Entry
Slin_5027         CDS       T01156                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase, E1 subunit
  KO
K00164  
2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
sli  Spirosoma linguale
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sli00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Slin_5027
  Amino acid metabolism
   00310 Lysine degradation
    Slin_5027
   00380 Tryptophan metabolism
    Slin_5027
Enzymes [BR:sli01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     Slin_5027
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
6128304..6131102
Genome map
AA seq 932 aa AA seqDB search
MDQYSYIANSDAAYVDQLYQSYKQDPQTVDESWQQFFKGFEFSLTYGEKANGNGAGTQAE
PGKSNGTALNGSSGNGQATAKPVDATHAEKEVSVASLIKAYRSRGHLLAKTNPLRERKDR
QPRVDLPDYALSEADLDTVFESGKLLGIGPATLRVIMDSLRKIYAGEIGFEYMYIRELDV
KNWLRNKIEKEALVFMPTLDEKKRILEKLNEATVFENFLATKYLGQKRFSLEGGEVTIPA
LDTIISQAADMGVEEVMIGMAHRGRLNVLANILGKSYESIFDGFEGNVPDQVHGDGDVKY
HLGYSSLTETKSGKQISVKLAPNPSHLEAVNPVVEGFVRAQADEEYQGDFTKIMPILIHG
DAAVAGQGIVYEVTQMAKLAGYTTGGTVHFVINNQIGFTTDFEDARSSIYCSDIAKIIDA
PIFHVNGDDPEAVIFCAKLAVEFREKFNRDVFIDMVCYRRYGHNEADEPKFTQPTMYNII
DKHQNPREIYKDLLIKRGDVDAELAQRMDTEFKKQLQDRLDRVKQKAEIPYKPLRLDRDW
SELRFSEPSDFDNSPETGVPAETLQTIGNALVKLPEGFKPLKQIDKLLKDRQTMLNDTKM
VNWGTAELLAYGSLLLEGRAVRLSGQDVQRGTFSHRHAVLHDSETNASYSSLDYIQDGQQ
KFQIYNSLLSEYGVLGFEYGYAMANPQALVIWEAQFGDFSNGAQLIIDQFIAAAESKWGI
QNGVTMLLPHGYEGQGPEHSNARPERYLQLYAEYNMVVANITTPANLFHVMRRQLAWAFR
KPLVIMSPKSLLRHPKCISPLEDLTKGSFQEIIDDSYAQAKKVTRVLLCTGKVYYDLLDK
QQADQRDDVAIVRIEQLAPLSKTQLNAVLEKYKKAEIFWVQEEPENMGYWTYLLRIGLNY
PIISRKASASPATGYPKIHSQEQADIVRRAFE
NT seq 2799 nt NT seq  +upstreamnt  +downstreamnt
atggatcagtactcatatatagccaactccgacgcggcttacgtagatcaactttatcag
tcttataaacaagacccacagacagttgacgaaagctggcagcaattttttaaagggttc
gagttttcactcacctacggtgaaaaagccaatggaaacggtgccggcactcaggccgag
ccaggcaaaagcaatggtacagccctaaacggctcatccggcaacggacaggccacggcc
aaaccagtggatgccacccacgccgaaaaggaagtctcggttgccagtttgatcaaggca
taccggtctcgtggtcacttgctggcgaaaaccaatccactccgcgaacgcaaagaccgg
caaccccgcgtcgatttgcccgattacgccctttccgaagccgatctggatacggtattc
gagtcaggtaaactgctcggaatcggaccggctacgctgcgcgttattatggattcgctg
cggaaaatctacgctggtgaaattggatttgagtacatgtacatccgcgagctggatgta
aaaaactggttgcgcaataagattgagaaagaagcgctcgttttcatgcctaccctcgat
gagaaaaagcgtattctcgaaaaactgaacgaagctaccgttttcgaaaacttcctcgcc
acaaaatacctcggtcagaagcgtttttcgctggaaggtggtgaagtgaccattccggcc
ctcgacaccatcatcagccaggcggccgacatgggcgttgaagaggtaatgatcggtatg
gcacaccgcggacggcttaacgtactggccaatattctgggcaagtcgtacgagtcgatc
ttcgatggcttcgaaggcaacgtacccgatcaggtacacggcgatggtgacgtaaaatac
cacctcggctattcgagtctaaccgaaaccaaatcgggcaagcagatcagcgtgaagctg
gcccctaacccatcgcacctggaagcggttaaccccgttgttgaaggctttgtgcgggcg
caggccgacgaagaataccagggcgatttcaccaagatcatgcctatcctgatccacggc
gatgcagccgttgccggtcagggtattgtatatgaggtaacccaaatggcgaaactggcg
ggctatacgaccggcggtacagtccactttgttatcaacaaccagattggcttcaccacc
gatttcgaagatgcccgttcatctatttattgctcagacatcgccaaaatcatcgacgca
cctattttccacgtcaacggcgatgaccctgaagcggttattttctgcgctaaactagcg
gtagagttccgggagaagttcaaccgggacgtgtttatcgacatggtttgctatcgtcgc
tacggccacaacgaagccgacgagccgaagttcacgcagccgacgatgtacaacatcatc
gacaagcatcagaatccgcgtgaaatctacaaagacctgctcatcaagcggggcgatgtc
gatgcggaactggcgcaacgcatggatacggaattcaagaagcagttgcaggaccggctc
gaccgcgtcaagcaaaaagccgaaattccatacaaaccactgcgactcgaccgtgactgg
tcggaacttcgtttcagcgaaccctccgacttcgacaactcgcccgaaacgggagtaccg
gccgaaacactgcaaactattggcaacgcgctggtgaaattaccggaagggttcaagccg
ctgaagcagatcgacaagcttctgaaagaccggcaaacgatgctcaacgacaccaaaatg
gtgaactggggtacggccgaactgctggcctacggctcgctgctactcgaaggcagagct
gttcggctgagcggccaggatgtgcagcggggtacgttctcgcaccgccatgccgttctg
catgattccgagacgaatgcctcgtactcgtcactggattacattcaggatggtcagcag
aaattccagatatacaactccttgctgtcggaatacggcgtccttggcttcgaatatggt
tatgccatggcaaacccgcaggcgctggtgatctgggaagcacagttcggcgatttctcg
aatggtgctcagctcatcatcgaccagtttattgccgctgccgagtcgaaatggggtatc
cagaatggtgtaacgatgttgcttccccacggctacgaaggccaggggccggagcactcc
aacgcccgcccggaacggtatctgcaactttacgcagaatacaacatggtggtggctaat
attactactccggcaaacctgttccacgttatgcgtcggcaattggcctgggcattccgg
aagccgctggttatcatgtctcccaaatcgttgcttcgccatccgaaatgtatttccccg
ctggaggaccttactaaaggatcgttccaggaaattatcgatgatagctacgcacaggcg
aaaaaggtgacgcgcgtgctgctttgcacaggtaaagtctattacgacttactcgacaag
caacaggccgatcagcgcgacgacgtggccattgtacgcattgaacagttggctccactt
tccaaaacgcaactgaacgccgtgttggagaagtacaaaaaagccgaaatcttctgggta
caggaagagccggaaaacatgggctactggacgtacctgctacggattgggttgaactat
ccgatcatttcgcggaaagcttcggcttcacccgctaccggttacccaaaaatacattct
caggaacaagccgatatcgttcgaagagcgtttgaataa

DBGET integrated database retrieval system