KEGG   Streptomyces lincolnensis: SLINC_7141Help
Entry
SLINC_7141        CDS       T04801                                 

Definition
(GenBank) hypothetical protein
Organism
sls  Streptomyces lincolnensis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
8573906..8574949
Genome map
AA seq 347 aa AA seqDB search
MARMGEAVELQAGGRTVRLSSPGKVFFPERGFTKLDLARYYQAVAPGILRALRNRPTTLE
RYPEGVTGESFFQKRAPKNMPDWIPTAHITFPSGRSADEMCPTEEAAVLWAAQFGTLTFH
PWPVRRDDVDRPDELRIDLDPQPGTDYDDAVRAAHELRAVLEEFGGLRGWPKTSGGRGLH
VFVPIEPRWTFTQVRRAAIAVGREMERRMPDHVTIKWWKEERGERIFVDYNQTARDRTIA
SAYSVRPRPHAPVSAPLRWEEVGEAHPQDFDLATMPARFAELGDVHADMDDHAFSLDALL
DLARRDEHDHGLGDLPYPPEYPKMPGEPTRVQPSRAKKAPGVPPTAP
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
gtggctcgcatgggcgaagcggtggaacttcaggcgggcggccggaccgtgcggctgtcc
agtccgggcaaggtcttctttccggagcgcggcttcaccaagctggatctcgcccgctac
taccaggccgtcgcccccggcatcctgcgcgccctgcgcaaccgccccaccaccctcgag
cgctaccccgaaggagtgaccggcgagtcgttcttccagaagcgggcgcccaagaacatg
cccgactggattcccaccgcccacatcaccttccccagcggccgcagtgccgacgagatg
tgccccaccgaggaggccgccgtcctgtgggccgcccagttcggcaccctcaccttccac
ccctggccggtgcgccgcgacgacgtggaccgtcccgacgaactccgcatcgacctcgac
ccgcagcccggcacggactacgacgacgccgtgcgcgcggcgcatgaactgcgggcggtg
ctggaggagttcggcggtctgcggggctggcccaagacctccggcgggcgtgggctgcac
gtcttcgtgccgatcgaaccccgctggaccttcacccaggtccggcgcgccgcgatcgcc
gtcggacgcgagatggaacgccggatgccggaccacgtgaccatcaagtggtggaaggag
gagcggggcgagcgcatcttcgtcgactacaaccagacggccagggaccgcacgatcgcc
tccgcctactcggtacggccccgcccgcacgccccggtctccgcgccgctgcgctgggag
gaggtgggcgaggcgcacccccaggacttcgacctcgcgaccatgcccgcgcgcttcgcc
gaactcggcgacgtgcacgcggacatggacgatcacgccttctcgctggacgccctcctg
gacctcgcccgccgtgacgaacacgaccacggcctgggcgacctgccgtacccgcccgag
tatccgaagatgccgggggaacccacgcgggtacagccgagccgggccaagaaggcgccc
ggggtgccgcctacagctccttga

DBGET integrated database retrieval system