KEGG   Streptomyces lividans: SLIV_06370Help
Entry
SLIV_06370        CDS       T03222                                 

Definition
(GenBank) aminotransferase
  KO
K00823  
4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
slv  Streptomyces lividans
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:slv00001]
   00640 Propanoate metabolism
    SLIV_06370
   00650 Butanoate metabolism
    SLIV_06370
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SLIV_06370
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SLIV_06370
Enzymes [BR:slv01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     SLIV_06370
Amino acid related enzymes [BR:slv01007]
 Aminotransferase (transaminase)
  Class III
   SLIV_06370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1435999..1437282)
Genome map
AA seq 427 aa AA seqDB search
MTRDLFARHRAVLPDWLALYYEDPLEITHGEGRYVWDAAGNKYLDFFGGILTTMTAHALP
EVTKAVAEQAGRIVHSSTLYLNRPMVELAERVAQLSGIPDARVFFTTSGTEANDTALLLA
TAYRRSNAILAMRNSYHGRSFSTVGITGNRGWSPTSLSPLQTLYVHGGVRTRGPYADLDD
RDFIDACVTDLKDLLGHSRAPAALIAEPVQGVGGFTSPPDGLYAAFREVLHERGILWISD
EVQTGWGRTGEHFWGWQAHARSGPPDIVTFAKGIGNGMSIGGVVARAEIMNCLDANSIST
FGGTQVTMAAGLANLNHLLEHDLQGNARRVGGLLIERLRAVAAQVPHVREVRGRGLMIGV
ELTRPGTDEAAPEAASTVLEEARAGGLLVGKGGGHSTSVLRVAPPMSLTVAEAEEGAAIL
ERALRSI
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
gtgacccgtgacctcttcgcccgccaccgcgccgtcctgcccgactggctcgccctctac
tacgaggacccgctggagatcacccacggcgagggcaggtacgtctgggacgccgcaggc
aacaagtacctcgacttcttcggcggcatcctcaccacgatgaccgcgcacgccctgccc
gaggtcaccaaggccgtcgccgagcaggccggtcggatcgtccactcctcgaccctctac
ctcaaccggccgatggtcgaactcgccgaacgcgtcgcccagctgtccggcatccccgac
gcccgcgtcttcttcaccacctcgggcaccgaggccaacgacacggccctgctgctcgcc
accgcataccggcgcagcaacgcgatcctggcgatgcgcaacagctaccacggccgctcc
ttcagcaccgtcggcatcaccggcaaccgcggctggtccccgacctccctgtccccgctc
cagaccctgtacgtgcacggcggcgtccgcacccgcgggccctacgcggacctggacgac
cgggacttcatcgacgcctgcgtcaccgacctcaaagacctgctcggccacagccgcgcc
cccgccgccctgatcgccgaacccgtccagggcgtcggcggcttcacctccccgccggac
ggcctgtacgccgccttccgcgaggtgctgcacgagcggggcatcctgtggatctccgac
gaggtgcagaccggctggggccgcaccggcgagcacttctggggctggcaggcgcacgca
aggagcggcccgcccgacatcgtcaccttcgccaagggcatcggcaacggcatgtcgatc
ggcggggtcgtcgcccgcgccgagatcatgaactgcctggacgccaacagcatctccacc
ttcggcggcacccaggtcaccatggccgcgggcctcgccaacctcaaccacctcctggag
cacgacctccagggcaacgcccggcgcgtcggcggactgctcatcgaacgcctgcgcgcc
gtcgccgcccaggtgccgcacgtgcgcgaggtacgcgggcgcggactgatgatcggcgtg
gagctgacccggcccggcaccgacgaggccgcccccgaggcggcgtccaccgtactggag
gaggcccgcgccggcgggctgctcgtcggcaagggcggcggccacagcaccagcgtcctg
cgcgtcgccccgccgatgtccctcaccgtcgcggaggccgaggagggcgccgcgatcctc
gaacgcgccctgcggagcatctga

DBGET integrated database retrieval system