KEGG   Streptomyces lividans: SLIV_11830Help
Entry
SLIV_11830        CDS       T03222                                 

Definition
(GenBank) hypothetical protein
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
slv  Streptomyces lividans
Pathway
slv03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:slv00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    SLIV_11830
Enzymes [BR:slv01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     SLIV_11830
DNA repair and recombination proteins [BR:slv03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     SLIV_11830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AIJ13359
UniProt: A0A076M6L5
LinkDB All DBs
Position
2715885..2716733
Genome map
AA seq 282 aa AA seqDB search
MALSNLDKVLYPAAGLTKGELLHYYATTAEVLLPHLRDRAVSFLRYPDGPDGQVFFTKNV
PPGTPDWVTTAEVPRSEGPARMVLVQDLASLMWAANLVTEFHTHQWTVDDPGEADRLVFD
LDPGPPATVVQCCEVALWLRERLAADGIEAYAKTSGAKGLHLLAGVRGASSERVSEYAKG
LAVEAERALPELVVHRMTRSLRPGKVFVDWSQNAARKTTAAPYTVRARGVPAVSTPVTWE
EVAGCGRAERFVFLTPDVGRRVRDHGDLLAPLFDRRRAAALP
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
gtggccctcagcaacctggacaaggtgctgtatcccgcggccggcctcaccaagggcgag
ctgctgcactactacgcgacgaccgccgaggtgctgctgccgcacctgcgggaccgcgcg
gtctccttcctgcggtatccggacggcccggacggccaggtgttcttcaccaagaacgtg
ccgcctggtacgcccgactgggtcaccacggccgaggtgccccgctcggagggcccggcc
cggatggtgctggtgcaggacctggcgagcctgatgtgggcggcgaacctggtgaccgag
ttccacacccaccagtggaccgtggacgatcccggcgaggccgaccggctggtgttcgac
ctggacccggggccgcccgcgaccgtggtgcagtgctgcgaggtcgcgctgtggctgcgg
gagcggctggcggcggacgggatcgaggcgtacgccaagacctccggggccaaggggctg
cacctgctggcgggggtgcggggcgcgtcctcggagcgggtgtcggagtacgcgaagggg
ctcgccgtggaggcggagcgggcgctgccggagctggtggtgcaccggatgacgcgcagc
ctgcggcccgggaaggtgttcgtggactggagccagaacgccgcccgcaagaccacggcc
gccccgtacaccgtgcgcgcccgcggcgtgcccgcggtctccacgccggtgacgtgggag
gaggtcgccgggtgcgggcgggcggagcggttcgtcttcctgacgccggacgtcggacgg
cgggtgcgggaccacggcgacctgctggccccgctgttcgaccggcggcgggcggcagcg
ctgccctga

DBGET integrated database retrieval system