KEGG   Streptomyces lavendulae: SLAV_07660Help
Entry
SLAV_07660        CDS       T05314                                 

Gene name
ykoU1
Definition
(GenBank) putative ATP-dependent DNA ligase YkoU
Organism
slx  Streptomyces lavendulae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: ATZ23434
UniProt: A0A2K8P9L2
LinkDB All DBs
Position
complement(1689143..1690162)
Genome map
AA seq 339 aa AA seqDB search
MGAAGGAIELDAGGRTVRLSSPDKVYFPERGLTKRDVAEYYLAVADGITRALRDRPTTLE
RYPDGVEGESFFQKRAPKNLPDWIPTAHISFPSGRTADEICPTEPAAVLWAANLGCLTFH
PWPVRRADTDRPDELRIDLDPQPGTDYHHAVAAAHELRALLDELGLRGWPKTSGGRGLHV
FVPIAPRWTFTEVRRCAIALGRELERRMPEQVTTAWWKEERGERIFVDYNQTARDRTIAS
AYSVRPRPHAPVSAPLRWDEVDDAEPRDFDIVTMPARFAELGDLHADMDEHAFGLEAVLE
LAARDEHEHGLGDLPYPPDHPKMPGEPKRVQPSRAKHED
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgggtgctgcgggtggtgcgatcgagctcgacgccggcgggcggacggtacggctgtcc
agtccggacaaggtgtacttccccgagcgcggcctcaccaagagggacgtcgccgagtac
tacctggccgtggcggacgggatcacccgcgcgctgcgcgaccgccccaccaccctggag
cggtacccggacggggtggagggcgagtccttcttccagaagcgcgccccgaagaacctc
cccgactggatcccgaccgcccacatctccttccccagcgggcgcaccgcggacgagatc
tgcccgaccgagccggccgccgtcctgtgggccgccaacctgggctgcctcaccttccac
ccctggccggtgcgccgcgcggacaccgaccggccggacgaactgcgcatcgacctcgat
ccgcagccgggcaccgactaccaccacgcggtggccgccgcccacgaactgcgggcgctg
ctggacgaactgggtctgcgcggctggcccaagacctcgggcgggcgggggctgcacgtc
ttcgtgcccatcgccccgcgctggaccttcaccgaggtgcgccggtgcgcgatcgccctg
ggccgggagctggaacggcggatgcccgaacaggtcaccaccgcctggtggaaggaggag
cgcggcgagcgcatcttcgtcgactacaaccagaccgcccgcgaccggaccatcgcctcg
gcgtactccgtccgcccccgcccgcacgccccggtctccgcgccgctgcgctgggacgag
gtggacgacgcggaaccgcgcgacttcgacatcgtgaccatgccggcgcgcttcgccgaa
ctgggcgacctgcacgccgacatggacgagcacgccttcggcctggaggccgtgctggaa
ctcgccgcgcgggacgagcacgagcacgggctgggcgacctgccctatccgccggaccat
cccaagatgccgggcgagcccaagcgggtgcagccgagccgggcgaagcacgaggactga

DBGET integrated database retrieval system