KEGG   Solanum lycopersicum (tomato): 101258000Help
Entry
101258000         CDS       T02665                                 

Definition
(RefSeq) glutathione transferase GST 23-like
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
sly  Solanum lycopersicum (tomato)
Pathway
sly00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:sly00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    101258000
Enzymes [BR:sly01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     101258000
Transporters [BR:sly02000]
 Other Transporters
  Pores ion channels [TC:1]
   101258000
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_2 GST_C_3 GST_N_4 Tom37
Motif
Other DBs
NCBI-GeneID: 101258000
NCBI-ProteinID: XP_004229525
UniProt: K4AY19
LinkDB All DBs
Position
1
AA seq 223 aa AA seqDB search
MADEVKLYRTWSSPFGLRIVWALHIKGIEYEAIFEDLSQKSPQLLQYNPVHKKIPVLVHK
GKPICESLVILEYIDETWKETAPLLPQDPYEKAMARFWAKFVEDKLLPSVWSIFTEQGYD
AKKEAFVPAVQNLEIIEEQLKEKKFFGGESIGYVDLVLGWMAYLLDVFEEVLDLKLFDAD
KFPLLSGWMKNFCDAPAIKQHLPPRDKLVTKFQLLHEKFQTAN
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atggctgatgaagtgaagctttacaggacatggtcaagtccatttggtttgaggatcgtt
tgggcgctgcatatcaaagggatcgaatacgaagccatctttgaagatttgagccagaag
agccctcaactcctccagtataatcctgttcacaaaaagattcctgtacttgtacacaaa
ggcaaaccaatctgtgaatcactggtgattctcgagtatatcgacgagacatggaaggaa
acagctcctttgctgcctcaggatccttatgagaaagccatggcacgattttgggcaaaa
tttgtggaagacaagcttctgccatcagtatggagtatttttacagaacaaggatatgac
gcgaaaaaggaagcttttgttccagcagtgcaaaacctagaaatcattgaagagcaattg
aaagagaagaagttttttggtggagaaagtataggatatgtggatcttgtacttggttgg
atggcgtatcttcttgatgtgtttgaggaggtactcgatttgaagttgtttgatgcagac
aaattcccgctcttatcaggatggatgaagaacttttgtgatgctccggcaatcaaacaa
cacttgccaccacgagacaaactagtaaccaaattccaactgcttcatgaaaaatttcag
acagcaaattga

DBGET integrated database retrieval system