KEGG   Solanum lycopersicum (tomato): 101259643Help
Entry
101259643         CDS       T02665                                 

Definition
(RefSeq) beta-galactosidase 17
  KO
K12309  beta-galactosidase [EC:3.2.1.23]
Organism
sly  Solanum lycopersicum (tomato)
Pathway
sly00052  Galactose metabolism
sly00511  Other glycan degradation
sly00531  Glycosaminoglycan degradation
sly00600  Sphingolipid metabolism
sly00604  Glycosphingolipid biosynthesis - ganglio series
sly01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sly00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    101259643
  Lipid metabolism
   00600 Sphingolipid metabolism
    101259643
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    101259643
   00604 Glycosphingolipid biosynthesis - ganglio series
    101259643
   00511 Other glycan degradation
    101259643
Enzymes [BR:sly01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     101259643
Exosome [BR:sly04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101259643
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_35 Glyco_hydro_42 BetaGal_dom4_5
Motif
Other DBs
NCBI-GeneID: 101259643
NCBI-ProteinID: XP_004241854
LinkDB All DBs
Position
6
AA seq 714 aa AA seqDB search
MTTTLKKNGISSFRAVGLRFRAAAMAKKRRVGTTIFMLLLALLVFGAFAPAFAPLPSLSS
FSSRSDIARLNSMGDKNKFEIADDMFWKDGKPFQIIGGDLHYFRVLPEYWEDRLLRAKAL
GLNTIQTYVPWNLHEPREGQLVFTGIADIFSFLNLCQKLDLLVMLRVGPYICAEWDFGGF
PAWLLTIEPAVRLRSSDPAFINLVERWWGILLPKIVSYAYKNGGPIIMVQIENEFGSYGD
DKDYLHHLVRIARGHLGDDVTLYTTDGGSRENLNKGTIPGDSVFSAVDFSTGDDPWPNFK
LQKEFNAPGKSPPLSTEFYTGWLTHWGEHIANTDATVTASYLERILSKNGSAVLYMAHGG
TNFGFYSGANTGADETDYKPDLTSYDYDAPIKESGDIDNPKYQALRRVIAKYTAVPLPSV
PSNTEKKAYGLIKLQKTKSLFNIVDTTYFDGVTESENPLAMESLDQMFGFMLYVSDYKAK
ANGGLLFIPKVHDRAQVFISCPSDNYDENPEYVGTVARWSNTSIRLPHTQCTSDNRIYIL
VENMGRINYGKYIFDKKGILSPVYLDGKPLQKWKMLPIPFHNLNEDQKNNSVISDAYTDL
RESVQIKLKNKRNYHPVPAFYIGHLTVDEVKDTFLSFRGWSKGVVFINGFNLGRFWPSFG
PQCNLYVPAPILQEGKNLVVILELEAPNAELFVASVDHPDFTCGSSANSRVHQI
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atgactacaacactgaagaaaaacggcatttccagtttccgagcagtgggattgagattc
cgagcagcggcaatggcgaaaaaacgacgcgtcggaacgacgatcttcatgctcctttta
gctctcttagtattcggagctttcgcacctgcctttgctccgcttccttctctatcatct
ttttcttcccgttccgacatcgctagacttaattctatgggtgataagaacaaatttgag
attgcggatgatatgttctggaaagatgggaagccttttcagatcattggcggggacttg
cactattttcgggttcttccagagtactgggaagatcgactcctgagagcaaaggcatta
ggcttgaataccattcaaacatatgtcccatggaatttgcacgaaccaagggaaggtcaa
cttgtttttacaggaatagcagatatcttttcattcctcaatctatgtcagaaattggat
ctcctggtgatgctccgagttgggccttatatttgtgcagagtgggattttgggggtttc
cctgcttggttacttaccattgaacctgctgtaagacttagatcatcagatcctgctttc
attaatttggttgaaagatggtggggaattttgctgccgaagatagtctcttatgcttac
aaaaatggcggccctattataatggttcagatagaaaatgaatttggttcatacggagat
gacaaggactacctgcatcacttagtgaggatagcccgtggacaccttggagatgatgtt
actctatatacgaccgatggaggttcaagagaaaatcttaacaaagggactattcctgga
gattctgtcttttcagctgttgatttttcaacgggagatgatccatggcccaattttaag
ttgcagaaagagttcaatgcaccagggaaatcaccaccgctttcaacggagttctacact
ggttggctcacgcactggggagagcatattgcaaatactgatgcaactgttacagcatct
tacttagaaaggatcttgtcaaaaaatggatcagctgtgctctacatggcacatggtgga
acaaatttcgggttctatagtggtgcaaatactggtgcagatgagactgattacaagcct
gatcttacatcctatgattatgatgcacctatcaaagaatctggagatatagacaatcca
aaatatcaagctcttcgaagggtgattgctaaatatactgcagttcctcttccttcagtt
ccttccaatactgaaaagaaagcatatggacttattaagttgcagaagactaaatcattg
tttaacatagttgataccacatactttgatggtgtcactgaatctgaaaacccacttgca
atggagtctttggaccagatgtttggcttcatgctttatgtttctgattacaaagcaaaa
gctaatggaggtttgttattcataccaaaggtgcatgacagggcgcaagtattcatttca
tgcccttcagacaactatgacgaaaatccagaatatgtaggcactgtagctagatggtca
aatacttccatcaggcttcctcatactcaatgtacttcggataacagaatttatatactg
gtggaaaatatggggcgtataaattatgggaaatacatttttgacaagaagggtatactc
tctcctgtttatttagatggtaaaccgttgcagaagtggaaaatgttgccgattcctttt
cacaacctaaatgaggatcaaaagaataattctgttatttcagatgcatacaccgacctt
agagaatctgtgcagataaaacttaaaaacaaaagaaattatcatccagtgccagctttc
tacattggtcatcttacagttgatgaagtaaaagacacttttttgtcttttcgtggctgg
agtaaaggggttgtatttatcaatggatttaatttaggaaggttttggccgtcctttgga
ccccagtgcaacctttatgttcctgctccaatcctgcaagaaggaaaaaatctcgtggtt
attctcgaattagaggctccgaatgctgagttgtttgtggcctcagttgaccatccagat
ttcacatgtggttcttccgcaaattcacgagtgcatcaaatctga

DBGET integrated database retrieval system