KEGG   Solanum lycopersicum (tomato): 101262281Help
Entry
101262281         CDS       T02665                                 

Definition
(RefSeq) DNA ligase 1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
sly  Solanum lycopersicum (tomato)
Pathway
sly03030  DNA replication
sly03410  Base excision repair
sly03420  Nucleotide excision repair
sly03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:sly00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    101262281
   03410 Base excision repair
    101262281
   03420 Nucleotide excision repair
    101262281
   03430 Mismatch repair
    101262281
Enzymes [BR:sly01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     101262281
    6.5.1.6  DNA ligase (ATP or NAD+)
     101262281
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     101262281
DNA replication proteins [BR:sly03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    101262281
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     101262281
DNA repair and recombination proteins [BR:sly03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     101262281
   NER (nucleotide excision repair)
    Other NER factors
     101262281
   MMR (mismatch exicision repair)
    Other MMR factors
     101262281
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-GeneID: 101262281
NCBI-ProteinID: XP_004250982
UniProt: K4D9P5
LinkDB All DBs
Position
11
AA seq 802 aa AA seqDB search
MLCLSSYRFTQTTLLYNFSVKPSSIFLHFYKKKQLTLKPLFFSVNPNSNSRTMSDSPPAP
PRSAFAVLMANSKKKTTSSSPKKRKTPDVETSSKSPVVNQDSVLKPIKDTDLVNESKSEE
LEVKKRSQDSTLKPIEDTHLVNESKSEECVVKKRKMISPDESIVEIKKKAANFDPRKAVY
WGDGQRVPFMFVVKAFDAISKESGRIVITEIVTNMLRTVIETTPEDLLPVVYLAANKIAA
AHDGMELGIGDASIIKALAEACGAKEAHIKKQYKELGDLGLVAKASRSSQPLMHKPEALT
VAKVFDTFRIIAKESGKDSQEKKKNYIKSLLVAATDCEPQYLIRLLQTKLRIGLAEQTLL
VAIAHAFVYSDKHSSPPAGVDSPLEEAAKIVKQVYSVIPVYEKIIPALLADGVWKLSETC
GFSPGVPVGPMLAKPTKGVSEILDKFQDMEFTCEYKYDGERAQIHYMEDGSVEIYSRNAE
RNTGKFPDVVTAISRLKKSSATSFVLDCELVAYDREKQKILPFQVLTTRARKNVVISEIK
VNVCIYAFDILYLNGQPLLQEQLNVRREHLYKSFEEEPGYFQFATAVTSNDLEEITKFLE
DAVNGSCEGLIIKTLTKDATYEPSKRSNNWLKLKKDYMESIGDSLDLVPIGAFHGRGKRT
GVYGAFLLACYDSNNEEFQSICKIGTGFSELQLEERSSSLRSKVIPKPKSYYRYGETINP
DVWFEPTEVWEVKAADLTISPVHRAAQGIVDPAKGISLRFPRLSRVREDKKPEEASSAEM
VADMYNAQKHNQKNNQDDNDED
NT seq 2409 nt NT seq  +upstreamnt  +downstreamnt
atgttgtgtttgagttcatatcgtttcactcaaactactcttctttacaatttctccgtt
aaaccttcttcaatctttcttcatttctacaagaagaagcagttaactctcaaacccctt
ttcttctctgtaaaccctaattcaaattcaagaaccatgtctgattctcctcctgctcct
cctcgctctgcgtttgctgtacttatggcaaattccaagaagaaaacaacctcctcctca
cctaagaaacgtaaaaccccagatgttgaaacttcaagtaaaagccctgttgttaatcaa
gattcagttttgaagccaattaaggacaccgatttggtcaatgagtcgaaaagtgaggag
ttggaggtgaagaaacggagtcaagactcaactttgaagccaattgaggacacccatttg
gtcaatgagtcgaaaagtgaggagtgtgtggtgaagaaacggaaaatgattagtccagat
gagagcattgtggaaataaagaaaaaagctgcgaactttgatccaagaaaggctgtgtat
tggggagatggtcagagagtgccgttcatgtttgtagttaaggcgtttgatgcaatttca
aaggagtcagggcggattgtgatcactgaaattgtgactaatatgttgaggactgtgatt
gagacgacgcctgaggatttgttgcctgttgtgtaccttgctgctaataagattgcagct
gcacacgatgggatggagcttggtattggtgatgcttccattatcaaggcacttgctgaa
gcctgtggtgctaaagaagcacatatcaagaagcaatacaaggagcttggagatttgggc
cttgttgcaaaagcaagtcgttcatcacagcctctgatgcataaaccagaagcactgact
gttgccaaagtttttgacacatttcggatcattgccaaggaatctggaaaggatagtcag
gaaaagaaaaagaattacattaaatcactgcttgttgcagccactgattgtgaaccccaa
tatttgattcgtcttctccagacaaagctacgcattggtttggctgaacaaacactgtta
gtcgcaatagctcatgcttttgtgtactcagataagcattcatcacctcctgcaggtgta
gattctcctttggaagaggctgccaagattgttaagcaagtgtactctgtgattccagtt
tatgaaaaaattatccctgctcttctagctgatggtgtttggaagctttcagaaacatgc
ggtttctcacctggtgttcctgttggacctatgctagctaagccaaccaaaggagtatct
gaaattcttgataagtttcaggatatggagttcacatgtgaatacaagtatgatggtgaa
cgtgcccagatacactacatggaagatggttccgttgagatatacagccgaaatgcagaa
agaaatactggaaagtttcctgacgttgttactgctatctcaagattgaagaaatcatct
gcaacttcatttgttcttgactgtgaactggttgcatacgaccgtgagaaacagaagatc
ctgccctttcaggtccttactacacgtgctcgtaaaaatgttgtcattagtgaaatcaag
gtcaacgtgtgcatatatgcttttgatatcttgtatcttaatggacaaccacttcttcaa
gagcaacttaatgttcgcagagagcatctttacaagtcatttgaagaagaacctggatat
ttccagtttgctacagctgtaacctcaaatgatcttgaggaaataacaaaatttcttgaa
gatgcggtcaacggcagttgtgagggattgattatcaaaacactaactaaagatgctaca
tatgagccttcaaagcggtcaaataactggcttaaactgaagaaggactacatggagagt
attggcgactcactggatctggtaccaattggtgcttttcatggtcgggggaaacgtact
ggtgtttacggagcctttctcctagcttgttatgatagcaacaacgaggagtttcagagc
atctgtaaaatcggaactgggttttctgaattacagcttgaggaacgctcttccagcctt
cgttctaaagttattcctaaaccaaagtcatattacaggtatggggaaaccatcaatcca
gatgtttggtttgaacctaccgaggtctgggaagtgaaagctgctgatcttactatcagc
cctgtccaccgtgctgcccaaggtatcgtggatcccgcgaagggaatttcattacgattt
ccacgtctgagccgtgtacgagaagacaagaagcctgaggaggcctcatcagcagagatg
gtagcggatatgtataacgctcagaagcacaatcaaaaaaacaatcaggatgacaacgat
gaagactaa

DBGET integrated database retrieval system