KEGG   Solanum lycopersicum (tomato): 101266195Help
Entry
101266195         CDS       T02665                                 

Definition
(RefSeq) probable glutathione S-transferase parC
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
sly  Solanum lycopersicum (tomato)
Pathway
sly00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:sly00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    101266195
Enzymes [BR:sly01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     101266195
Transporters [BR:sly02000]
 Other Transporters
  Pores ion channels [TC:1]
   101266195
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_2 GST_C GST_C_5
Motif
Other DBs
NCBI-GeneID: 101266195
NCBI-ProteinID: XP_004251828
UniProt: K4DCL7
LinkDB All DBs
Position
12
AA seq 219 aa AA seqDB search
MSNEVVLLSAYVSMFGMRVRIALHEKGIQYEYKEEDLSNKSELLLQMNPIHKKIPVLIHN
GKPICESLIIVEYIDEVWKDKSPLMPFNPYKRAQARFWADFIDKKVYDSGKRIWATKGED
QEAAKKEFIEYLKLLEGELGDKTYFNGENFGFVDLALIPFYSWFPTFEKFGNFNIEKECP
KFVAWANKCIYKDSVSKSLAESNKVYEYVLKMKQHLGLP
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgagtaatgaagttgttcttttgagtgcttatgtgagtatgtttggtatgagggtaaga
attgcattacatgaaaaagggattcaatatgaatataaagaggaagatttgagtaataaa
agtgaacttttattacaaatgaatccaattcataagaaaattccagtgttaattcataat
ggaaaaccaatttgtgagtcacttataattgttgagtacatagatgaagtttggaaggac
aaatctcctttgatgccttttaatccttataagagggctcaagctaggttttgggctgat
tttattgacaaaaaggtctatgatagcggaaagagaatatgggctacaaaaggagaagat
caagaggcagccaagaaagaattcatagaatacctaaaactattggaaggagaattagga
gataagacatatttcaatggagaaaattttggatttgtggatttggctttaattcctttc
tatagttggttcccaacttttgagaaatttgggaattttaacatagagaaagagtgtcca
aagtttgtggcatgggccaacaaatgtatatataaagatagcgtctccaaatctctagcg
gaatcaaataaagtttatgagtatgtgttaaaaatgaaacaacaccttggccttccatag

DBGET integrated database retrieval system