KEGG   Solanum lycopersicum (tomato): 101268081Help
Entry
101268081         CDS       T02665                                 

Definition
(RefSeq) histone-lysine N-methyltransferase ASHH3-like
  KO
K11423  
histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
sly  Solanum lycopersicum (tomato)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:sly00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    101268081
Enzymes [BR:sly01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     101268081
Chromosome [BR:sly03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     101268081
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
12
AA seq 370 aa AA seqDB search
MPAMKTAIHGGIGHVFSKLIKEIGDPVDFELPDWLNKWQSMPYTFIKRNIYLTKKVKRRL
EDDGIFCSCSSTAETSVVCGKDCLCGIMLSSCSSGCKCGSSCLNKPFHQRPVKKMKLVKT
EKCGSGIVADEDIKRGDFVIEYVGEVIDDKTCEERLWKMKHSGETNFYLCEINRDMVIDA
TYKGNKSRYINHSCCPNTEMQKWMIDGETRIGIFATRDIKRGEHLTYDYQFVQFGADQDC
HCGAVRCRRKLGVKPNKPKLPASDTALKIVACQVAATSPKLKALLSTRHVYQTGVPRIGS
SVYDSDIKIRRPRSCIGQVIRIIRSSKTRSFGIVKRFDAITKKHFIMFEDGCVQYLDLSK
EDWEFCNFLE
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgcctgctatgaagactgctattcatggtgggattgggcacgtattcagcaaactaata
aaggagattggtgatcctgttgactttgaacttccagattggttaaataaatggcagtca
atgccctatacctttattaagcgcaatatatacctcactaagaaggtaaagcgacgtctg
gaagatgatggtatattttgttcctgcagctcaacggcagaaacttctgttgtgtgtggc
aaggattgtctctgtggcataatgttgtctagctgctcctcgggttgtaaatgtgggagt
tcttgtctgaataagccattccatcaacgtcctgtgaagaagatgaaattagtgaagact
gaaaaatgtggctctggaattgtggcagatgaagatatcaaacgaggagactttgttata
gagtatgttggagaagttattgatgacaaaacatgtgaagagaggctttggaaaatgaag
catagtggagaaacaaacttctacttgtgtgaaatcaatcgggatatggtgattgatgcc
acttacaagggcaacaaatcccgatacattaatcatagttgttgtccaaatactgagatg
cagaaatggatgattgatggtgaaacaagaattggcatatttgcaacacgagacattaaa
aggggcgagcatctgacctatgattaccagtttgttcagtttggtgcagatcaagattgc
cactgtggtgctgtaagatgtaggcgaaagctgggcgttaaacctaacaaaccaaaactc
cctgcttcagataccgcattaaagatagtggcatgtcaggtggctgccacctctcccaaa
ttgaaagcacttctatctacacgtcatgtttatcaaactggagttccacgaataggaagc
tcagtttatgattctgacataaaaataaggcgacctcgtagttgcattggccaagttata
agaataattcgctcctctaaaacaaggtcctttggaattgtaaaacggtttgatgccatc
accaaaaaacattttatcatgtttgaagatggctgtgttcagtaccttgacctgtcaaaa
gaagattgggaattctgtaactttcttgagtaa

DBGET integrated database retrieval system