KEGG   Solanum lycopersicum (tomato): 3950460Help
Entry
3950460           CDS       T02665                                 

Gene name
rbcL, LyesC2p061
Definition
(RefSeq) ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
sly  Solanum lycopersicum (tomato)
Pathway
sly00630  Glyoxylate and dicarboxylate metabolism
sly00710  Carbon fixation in photosynthetic organisms
sly01100  Metabolic pathways
sly01200  Carbon metabolism
Module
sly_M00165  Reductive pentose phosphate cycle (Calvin cycle)
sly_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
sly_M00532  Photorespiration
sly_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:sly00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    3950460 (rbcL)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    3950460 (rbcL)
Enzymes [BR:sly01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     3950460 (rbcL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-GeneID: 3950460
NCBI-ProteinID: YP_008563096
UniProt: P27065 A0A0C5CHE6
LinkDB All DBs
Position
CP
AA seq 477 aa AA seqDB search
MSPQTETKASVGFKAGVKEYKLTYYTPEYQTKDTDILAAFRVTPQPGVPPEEAGAAVAAE
SSTGTWTTVWTDGLTSLDRYKGRCYRIERVVGEKDQYIAYVAYPLDLFEEGSVTNMFTSI
VGNVFGFKALRALRLEDLRIPPAYVKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGL
SAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFCAEALFKAQTETGEIKGHYL
NATAGTCEEMIKRAVFARELGVPIVMHDYLTGGFTANTTLAHYCRDNGLLLHIHRAMHAV
IDRQKNHGIHFRVLAKALRMSGGDHIHSGTVVGKLEGERDITLGFVDLLRDDFVEQDRSR
GIYFTQDWVSLPGVLPVASGGIHVWHMPALTEIFGDDSVLQFGGGTLGHPWGNAPGAVAN
RVALEACVKARNEGRDLAREGNEIIREACKWSPELAAACEVWKEIVFNFAAVDVLDK
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgtcaccacaaacagagactaaagcaagtgttggattcaaagctggtgttaaagagtac
aaattgacttattatactcctgagtaccaaaccaaggatactgatatattagcagcattc
cgagtaactcctcaacctggagttccacctgaagaagcaggggccgcggtagctgccgaa
tcttctactggtacatggacaactgtatggaccgatggacttaccagtcttgatcgttac
aaagggcgatgctaccgcatcgagcgcgttgttggagaaaaagatcaatatattgcttat
gtagcttaccctttagacctttttgaagaaggttccgttaccaatatgtttacttccatt
gtaggtaacgtatttgggttcaaagccctgcgcgctctacgtctggaagatctgcgaatc
cctcctgcttatgttaaaactttccaaggtccgcctcatgggatccaagttgaaagagat
aaattgaacaagtatggtcgtcccctgttgggatgtactattaaacctaaattggggtta
tctgcaaaaaactacggtagagctgtttatgaatgtcttcgcggtggacttgattttacc
aaagatgatgagaacgtgaactcacaaccatttatgcgttggagagatcgtttcttattt
tgtgccgaagcactttttaaagcacagactgaaacaggtgaaatcaaagggcattacttg
aatgctactgcaggtacatgcgaagaaatgatcaaaagagctgtatttgctagagaattg
ggcgttccgatcgtaatgcatgactacttaacggggggatttaccgcaaatactaccttg
gctcattattgccgagataatggtctacttcttcacatccaccgtgcaatgcatgcggtt
attgatagacagaagaatcatggtatccacttccgggtattagcaaaagcgttacgtatg
tctggtggagatcatattcactctggtaccgtagtaggtaaacttgaaggtgaaagagac
ataactttgggctttgttgatttactgcgtgatgattttgttgaacaagatagaagtcgc
ggtatttatttcactcaagattgggtctctttaccaggtgttctacctgtggcttcagga
ggtattcacgtttggcatatgcctgctctgaccgagatctttggggatgattccgtacta
cagttcggtggaggaactttaggacatccttggggtaatgcgccaggtgccgtagctaat
cgagtagctctagaagcatgtgtaaaagctcgtaatgaaggacgtgatcttgctcgggaa
ggtaatgagattattcgcgaggcttgcaaatggagcccggaactagctgctgcttgtgag
gtatggaaagagatcgtatttaattttgcagcagtggacgttttggataagtaa

DBGET integrated database retrieval system