KEGG   Staphylococcus lutrae: B5P37_02605Help
Entry
B5P37_02605       CDS       T04991                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
slz  Staphylococcus lutrae
Pathway
slz00240  Pyrimidine metabolism
slz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:slz00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    B5P37_02605
Enzymes [BR:slz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     B5P37_02605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK
Motif
Other DBs
NCBI-ProteinID: ARJ50284
UniProt: A0A1W6BKH5
LinkDB All DBs
Position
complement(514718..515320)
Genome map
AA seq 200 aa AA seqDB search
MYEAYHSGWIECITGSMFSGKSEELIRRLRRGVFAKQKVVVFKPVIDDRYHKEKVVSHNG
NEIEAINISKASEIWQHDLTGVDIIGIDEIQFFDQEIVHVAEMLAEKGYRVITAGLDMDF
KGEPFHPVPEMLAVSEHITKLQAVCAVCGASSSRTQRLIDGKPAKVDDPIILVGADERYE
PRCRAHHVVAPSENKKEALE
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgtatgaagcgtatcattcaggttggatagaatgcattactggaagtatgtttagcggt
aaatcagaagaactgattagacgtttgcgtcgaggcgtttttgctaaacaaaaagtggtt
gtatttaagccggttattgacgatcgctaccacaaagagaaagttgtatctcacaatggt
aatgaaatagaagcgattaatatttcaaaagcgagtgaaatatggcagcatgatttgaca
ggcgttgacattatcggaatagacgaaattcaattttttgatcaagaaattgtacacgtt
gctgaaatgcttgctgaaaaaggttatcgtgtgattactgctggacttgatatggatttt
aaaggcgaaccttttcaccctgttcctgaaatgctcgcagtgagtgaacatattacaaag
ttacaagccgtatgcgcagtgtgtggggcttcatcaagtcggacacagcgtcttattgat
ggtaaaccggctaaagtagacgatcccattatcttggtaggtgcagacgaacgctatgaa
ccccgttgtcgggcacatcacgttgttgcaccaagtgaaaataaaaaggaggcgttagaa
taa

DBGET integrated database retrieval system