KEGG   Streptomyces avermitilis: SAVERM_1696Help
Entry
SAVERM_1696       CDS       T00126                                 

Definition
(GenBank) putative DNA primase, small subunit
Organism
sma  Streptomyces avermitilis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NITE: 
UniProt: 
LinkDB All DBs
Position
complement(2074412..2075428)
Genome map
AA seq 338 aa AA seqDB search
MGDAVELEAAGRTVRLSSPDKIFFPERGFTKLDVAQYYLAVGDGILRALRNRPTTLERYP
DGMSGESFFQKRAPKNMPDWIPTAHITFPSGRSADEMCPTEVAAVVWAAQFGTLTFHPWP
VRRDDVDHPDELRLDLDPQPGTDYADAVRAAHELRAVLHEYGDLRGWPKTSGGRGLHVFV
PIERRWTFTQVRRAAIAAGRELERRMPDQVTTAWWKEERGEKIFVDYNQTARDRTIASAY
SVRPRPHAPVSAPLRWDEVGDARPRDFDIATMPRRYAELGDVHADMDDHAFSLEALLELA
DRDEHDHGLGDLPYPPEYPKMPGEPKRVQPSRAKHGDG
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgggcgatgcggtggagctggaggcggcgggcaggacggtacggctgtccagcccggac
aagatcttctttccggagcgcggcttcacgaagctcgacgtagcccagtactacctcgcc
gtcggcgacgggatcctgcgcgccctgcgcaaccgccccacgaccctggagcgctacccg
gacggtatgagcggcgagtccttcttccagaaacgggcgcccaagaacatgcccgactgg
atccccaccgcccacatcaccttccccagcggccgcagcgccgacgagatgtgccccacc
gaggtggccgccgtggtgtgggccgcgcagttcggcacgctcaccttccacccgtggccg
gtgcgtcgcgacgacgtcgaccaccccgacgaactccgcctcgacctcgacccgcagccc
ggcacggactacgccgacgccgtacgcgccgcccacgaactgcgcgccgtcctgcacgag
tacggcgatctgcgcggctggcccaagacatccgggggccgcgggctgcatgtcttcgtc
ccgatcgagcgacgctggaccttcacccaggtgcgccgtgccgcgatcgccgccggacgc
gaactggaacggcgcatgcccgaccaggtcaccaccgcctggtggaaggaggaacgcggc
gagaagatattcgtcgactacaaccagaccgcccgcgaccgcaccatcgcctccgcctac
tccgtacgcccccgcccgcacgctcccgtctccgcgcccctgcgctgggacgaggtcggg
gacgcgcggccccgcgacttcgacatcgcgaccatgccccggcggtacgccgaactgggc
gacgtccacgcggacatggacgaccacgccttctccctggaggccctgctggaactcgcc
gaccgcgacgagcacgaccacggcctgggcgacctcccgtacccgcccgaatatccgaag
atgccgggcgagccgaaacgcgtccagccgagccgggcgaagcacggggacggctga

DBGET integrated database retrieval system