KEGG   Streptomyces avermitilis: SAVERM_1697Help
Entry
SAVERM_1697       CDS       T00126                                 

Gene name
ligC
Definition
(GenBank) putative DNA ligase
Organism
sma  Streptomyces avermitilis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-ProteinID: BAC69408
NITE: SAV1697
UniProt: Q82MG3
LinkDB All DBs
Position
2075503..2076573
Genome map
AA seq 356 aa AA seqDB search
MDLPVMPPVKPMLAKSVAKIPPDMQYEAKWDGFRAIVFRDGTEVELGSRTGKPLTRYFPE
LVEALRDRLPERCVIDGEIVIARDGRLDFDALTERIHPAESRVRMLAEKTPASFVAFDLL
ALADDSLLDTPLTERRALLESALSGVTAPVHVAPATTDREVAEQWFEQYEGAGLDGVIAK
PLTLRYRQDERAMFKVKHERTADVVVAGYRLHKSGPVVGSLLLGLYDDRGALQHVGVSAA
FPMKRRAELVEELEPLRMEDAAGHPWAAWSNEAAHETARLPGAPSRWSGKKDLSWVPLRP
ERVAEVAYDHMENGARFRHTARFRRWRPDRTPESCTYAQLEEPVSYDLTEILGSRG
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atggatctgccggtgatgccgcccgtgaagccgatgctcgccaagtccgtggcgaagatc
ccgccggacatgcagtacgaggcgaagtgggacgggttccgggcgatcgtgttccgcgac
ggcaccgaggtggagctcggcagtcggaccggaaagccactgaccaggtactttcccgag
ctggtcgaggcgttgcgggaccggttgcccgagcgctgtgtgatcgacggtgagatcgtg
atcgcccgggacgggcggctcgacttcgacgcgctcaccgagcgcattcatccggccgag
tcgcgggtgcggatgctggccgagaagacgccggcctcgttcgtggcgttcgatctgctg
gcgctggccgacgactcactgctcgacactccgctgaccgaacggcgcgccctgctggag
tcggcgctgtcgggggtgacggcccccgtccatgtcgccccggcgaccacggaccgcgag
gtggccgagcagtggttcgagcagtacgagggcgcgggcctggacggcgtgatcgccaag
ccgctcacattgcgctatcggcaggacgagcgcgccatgttcaaggtcaagcacgagcgt
acggcggacgtggtggtcgcgggctaccgcctgcacaagagcggcccggtcgtcggctcg
ctgctgctcgggctgtacgacgaccggggcgccctgcaacacgtcggggtgtccgccgcg
ttccccatgaagcgtcgcgccgagctggtggaggagctggagccgctgcgcatggaagac
gccgcggggcacccttgggcggcctggtcgaacgaggcggcgcacgagacggcgcggctg
cccggcgcacccagtcgctggtcggggaagaaggacctctcctgggtgccgctgcggccc
gagcgggtggcggaggtggcgtacgaccacatggagaacggcgcacgcttccggcacacg
gcccgcttccgccgctggcgccccgaccgcacccccgagagctgcacctacgcgcaactg
gaggagccggtgagctacgacctgacggagatcctcggctcgcggggctga

DBGET integrated database retrieval system