KEGG   Streptomyces avermitilis: SAV_1552Help
Entry
SAV_1552          CDS       T00126                                 

Gene name
pks2-3
Definition
(GenBank) putative non-ribosomal peptide synthetase
Organism
sma  Streptomyces avermitilis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NITE: 
UniProt: 
LinkDB All DBs
Position
complement(1910558..1912282)
Genome map
AA seq 574 aa AA seqDB search
MARSLVDLLTKHASHQPDRTAYRYLVTGDRDGEIQDISYGRLAERSRAVASWLQERGLAG
SRAMLLYPPGLEFICGYLGCLSAGVVAVPGVPPQGRSQNHRALTRMKRLIADADAKVILG
GREVIAALGTMAEHLPELAEITCVATEDIPDAAAGSWREPDLTADSVAFLQYTSGSTSAP
RGVMVTHGNLLDNERVITERMGHTPDTIAEYDHELFVSWLPVYHDMGLIGPVLNTVYLGA
TATLFSPLHFLQQPQRWLTALSHYRPHTSGGPNFAYELCLKQATPDLLDGLDLSRWKVAF
NGAEPVRAATLRRFTETFGTAGFRREALYPCYGLAEATLMVTGGSVAAPPTLIEAPETGP
HAGAADAAAVGSGRPGPGVTLVIADPERQQELPDGEVGEIWVLGASVAKGYWRNTLATRE
SFRATLKNREGRFLRTGDLGFLRDGELFVTGRLKDLIVIDGRNHYPQDLELSAEMSHPAL
RPGCTATFSVDGGVEGEQPVIVAEAAPEAADEFEKITDRIRSAIGEAHGLSVRDVVLVHP
GTIPKTSSGKIQRRASRTAYLDGTLSVVGAAATR
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atggctcgatccctggtcgacttactgaccaagcacgcctcgcaccagcccgaccggacc
gcctaccgctatctcgtcacgggcgaccgtgacggagagatccaggacatctcgtacggg
cggctggccgaacggtcccgcgccgtcgcctcctggcttcaggagcgcggcctggccggc
tcccgcgccatgctgctgtatccgcccggtctcgagttcatctgcggctacctgggctgc
ctttcggccggggtcgtcgccgtgccgggcgtgcccccgcagggccggtcgcagaaccac
cgcgccctgacccggatgaagcgcctgatcgccgacgcggacgccaaggtgatcctgggc
ggccgtgaggtgatcgccgccctgggcaccatggcggagcacctgcccgaactggccgag
atcacctgcgtcgccaccgaggacatcccggacgcggcggccggctcctggcgcgaaccc
gacctcaccgccgactcggtcgccttcctccagtacacctcagggtcgacctccgctccg
cgcggcgtgatggtgacccacgggaacctgctggacaacgaacgggtcatcacggaacgg
atgggccacactcccgacaccatcgcggagtacgaccacgaactgttcgtcagctggctg
cccgtgtaccacgacatgggcctcatcggcccggtgctgaacacggtctacctcggcgcg
accgccacactcttctcgccgctgcacttcctccagcagccgcagcgctggctgaccgcc
ctcagccactaccgcccgcacaccagcggcggccccaacttcgcgtacgagctgtgcctg
aagcaggccactcccgacctcctcgacggcctcgacctgagccggtggaaggtcgccttc
aacggcgccgaaccggtgcgggccgccaccctgcggcggttcaccgagacgttcggcacg
gccgggttccgtcgcgaggcgctctacccgtgctacgggctggccgaagccaccctgatg
gtcaccggcggctcggtggcggccccgcccactctgatcgaggcccccgagaccggaccg
cacgccggcgcggcggacgcggcggcggtcggctccggccggcccggccccggtgtgacc
ctggtgatcgccgacccggagcggcagcaggaactgcccgacggcgaggtcggcgagatc
tgggtcctgggcgcgagcgtcgccaagggctactggcgcaacaccctcgccacccgcgag
agcttccgcgccaccctgaagaaccgtgagggccgcttcctgcggaccggcgacctcggc
ttcctgcgtgacggcgaactgttcgtcaccggccgcctcaaggacctgatcgtcatcgac
ggacgcaaccactacccgcaggacctggagctgtcggcggagatgtcccacccggcgctg
cggcccggctgcaccgccacgttctccgtggacggcggagtggagggcgaacagcccgtc
atcgtcgccgaggcggccccggaggcggcggacgagttcgagaagatcaccgaccggatc
cgcagcgcgatcggcgaggcccacggactgtcggtgcgtgatgtcgtgctggtccatccc
ggcaccatccccaagacgtccagcgggaagatccagcgccgcgcctccaggacggcgtac
ctcgacggcaccctctccgtggtcggcgcggccgccacgagatga

DBGET integrated database retrieval system