KEGG   Streptomyces avermitilis: SAV_1603Help
Entry
SAV_1603          CDS       T00126                                 

Gene name
fadD7
Definition
(GenBank) putative acyl-CoA synthetase, long-chain fatty acid:CoA ligase
  KO
K01897  
long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
sma  Streptomyces avermitilis
Pathway
Fatty acid biosynthesis
Fatty acid degradation
Metabolic pathways
Fatty acid metabolism
Quorum sensing
Module
beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:sma00001]
 Metabolism
  Lipid metabolism
   00061 Fatty acid biosynthesis
    SAV_1603 (fadD7)
   00071 Fatty acid degradation
    SAV_1603 (fadD7)
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    SAV_1603 (fadD7)
Enzymes [BR:sma01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     SAV_1603 (fadD7)
Lipid biosynthesis proteins [BR:sma01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   SAV_1603 (fadD7)
Exosome [BR:sma04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   SAV_1603 (fadD7)
  Exosomal proteins of breast cancer cells
   SAV_1603 (fadD7)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NITE: 
UniProt: 
LinkDB All DBs
Position
complement(1969300..1970811)
Genome map
AA seq 503 aa AA seqDB search
MAATLSLAAILAENARRRPEKTALVEGELRLTFAEVWQRARAQAGALVGLGVRPGDRVAL
MAPNTADFPHAYYAIAAAGGVVVPVHLLLSASEVEHVLKDSGATLLLCHPAQAETGTAAA
QAVGVQVITLGAEFEKLARIAEPLPSYVTRAADDPAVVFYTSGTTGVPKGAVLSHFNLVM
NATVNAFDANDIRPDDVALGALPLFHAFGQTVSMNSTWRAGATLVLLPRFDAARAIELMV
KEGVNTFHGVPTMFVALAGAAAAMDALPELRVCVSGGASLPLAVLERFEEAFGAKIYEGY
GLSETSPTATVNQPVFGTRAGTIGHPLWGVDVEIARAEVEGRVELLPPGELGEVVVRGHN
VFSGYLGRPEATAETLVDGWLRTGDLGTKDDEGFLRIVDRKKDVIIRGGYNVYPREVEEV
LLRHPGVAQAAVIGLPDELHGEEVCAVVVRATGAVPEAAEITEWSKEHLGRHKYPRRVEF
TDALPLGPSMKILKRELRVRYAQ
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggccgccaccctctccctcgccgcgatcctcgccgagaacgcccgccgccgccccgag
aagacggcgctcgtcgagggcgagctgcgcctcaccttcgccgaggtgtggcagcgcgcc
cgcgcccaggccggcgccctcgtcggtctcggcgtacggccgggggaccgggtggcgctc
atggcgcccaacaccgccgacttcccccacgcctactacgcgatcgccgcggccggcggt
gtggtcgtcccggtccatctcctgttgtcggcgtccgaggtcgagcacgtcctgaaggac
agtggcgccacactgctcctgtgccaccccgcgcaggccgagaccggtacggccgccgct
caggccgtcggcgtccaagtcatcacgctgggcgccgagttcgagaagctggccaggatc
gccgagccgctgccctcgtacgtcacccgcgcggcggacgacccggccgtcgtgttctac
accagcggaaccaccggcgtccccaagggcgccgtgctcagccacttcaacctggtcatg
aacgcgaccgtcaacgccttcgacgccaacgacatccgccccgacgacgtcgccctcggc
gctctcccgctgtttcacgccttcggccagacggtctccatgaactccacctggcgcgcg
ggcgcgacgctcgtcctgctcccgcgcttcgacgcggcgcgcgcgatcgagctgatggtg
aaggagggggtgaacacgttccacggtgtcccgacgatgttcgtcgccctggcgggcgcc
gccgcagccatggacgcgctgcccgagctgcgcgtctgcgtgtcgggcggcgcctcgctg
ccactcgccgtactggaacgcttcgaggaggcgttcggcgcgaagatctacgaggggtac
gggctgtcggagacctcgccgaccgcgaccgtgaaccagcccgttttcggcaccagggcg
ggcaccatcgggcacccgctgtggggcgtggacgtcgagatcgcgcgtgccgaggtcgaa
ggacgcgtcgaactgctgccgcccggcgagctgggcgaggtcgtcgtccggggccacaac
gtcttctccggttacctcggccgccccgaagccaccgccgagacgctcgtcgacggctgg
ctgcgcaccggcgacctcggcaccaaggacgacgagggcttcctgcggatcgtcgaccgc
aagaaggacgtcatcatccgcggcggctacaacgtctacccgagggaggtcgaggaggtg
ctcctgcgccaccccggcgtcgcccaggccgccgtgatcggactgccggacgagctgcac
ggcgaagaggtgtgcgcggtcgtcgtacgcgccacgggcgccgtcccggaggccgccgag
atcaccgagtggtcgaaggagcatctggggcggcacaagtacccgcggcgcgtcgagttc
acggacgccctgccgctgggcccgagcatgaagatcctcaagcgggagctgagggtgcgg
tacgcacaatga

DBGET integrated database retrieval system