KEGG   Streptomyces avermitilis: SAV_178Help
Entry
SAV_178           CDS       T00126                                 

Definition
(GenBank) putative NLP/P60-family secreted protein
Organism
sma  Streptomyces avermitilis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NITE: 
UniProt: 
LinkDB All DBs
Position
201219..202370
Genome map
AA seq 383 aa AA seqDB search
MRTARRRKTQWGCVVVLLLFAAVCCAAPAGNAISAYVALKTGASADGGVAEGGTAADIPP
RMLTAYKKAVQQVGKHVPKCQGMRWPILAGIAKVESNHAVGRNIADNGDIRPRIYGVLLN
GSGAGGNTTAFPDTDGGKWDGTASGERAVGPFQFLPSTWEGIGEDANGDKTADPHNADDA
ALGAAAYLCGNGRDLTKRAQLKAAILQYNHSNEYVSNVLGWIDQYTAAAKDPDLKNVTGK
VRTVIEAALSQRGVPYSWGGGNASGRSYGICCSPSGKSGASIKGFDCSGLTLYAYAKAGI
QLPRTAAAQAGVGQRIPTSLGSDALNAGDLVFYADAPGHDSTIYHVGIYVGSGQMVNAAR
PGTVVRLDAVNAMSGYAGGARLL
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
gtgaggacggcccggcgccgcaagacgcagtgggggtgtgtggtggtgctgttgctgttc
gccgccgtgtgctgtgccgcaccggcagggaacgcgatcagcgcgtacgtggcgctgaag
acgggtgcgagcgccgacggcggggtcgccgaaggcggcaccgctgcggacatcccgccg
cgcatgctcaccgcctacaagaaggccgtccagcaggtcgggaagcatgtgcccaagtgc
cagggcatgcgctggccgatcctggccgggatcgccaaggtcgagtccaaccacgccgtg
ggccggaacatcgccgacaacggcgacatccgcccgcgcatctacggggtgctcctcaac
ggctccggggccggcgggaacaccaccgccttcccggacaccgacggcggcaagtgggac
ggaaccgccagtggggagcgcgcggtcggacccttccaattcttgccgtcgacctgggag
ggcatcggcgaggacgcgaacggggacaagacggccgacccgcacaacgccgacgacgcc
gcgctcggcgccgcggcctatctctgcggcaacggacgggacttgaccaagcgggcgcag
ctcaaggcggcgatcctccagtacaaccactccaatgagtacgtctcgaacgtgctgggc
tggatcgaccagtacacggcggccgcgaaggacccggacctgaagaacgtcacgggcaag
gtccgcaccgtcatcgaggcggcgctctcccagcggggcgtgccctactcgtggggcggc
ggcaacgcgagcggcaggtcgtacggcatctgctgctcccccagcggaaagagcggcgca
agcatcaagggtttcgactgctcggggctgaccctgtacgcctacgcgaaggctggcatt
cagctgccgcgtacggcggctgcgcaggccggggtcggccagcgcatccccacgagtctc
gggtccgatgcgctcaacgccggcgatctcgtcttctatgccgacgctcccggtcatgac
tcgacgatctatcacgtcgggatttacgtgggcagcgggcagatggtcaacgccgcccgt
ccggggaccgttgtccgcctggacgcggtcaacgcgatgtcgggatacgcgggaggggcc
cgcctgctgtga

DBGET integrated database retrieval system