KEGG   Streptomyces avermitilis: SAV_2030Help
Entry
SAV_2030          CDS       T00126                                 

Definition
(GenBank) putative acyl-CoA synthetase
  KO
K00666  
fatty-acyl-CoA synthase [EC:6.2.1.-]
Organism
sma  Streptomyces avermitilis
Brite
Enzymes [BR:sma01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.-  
     SAV_2030
Lipid biosynthesis proteins [BR:sma01004]
 Acyl-CoA synthetase
  Unknown
   SAV_2030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NITE: 
UniProt: 
LinkDB All DBs
Position
complement(2472283..2473905)
Genome map
AA seq 540 aa AA seqDB search
MTELSYAHGTSTTPLLGDTIGANLDRAIAAYPDRDALVDVPSGRRWTYAEFGAAVDEVAL
GLLAKGVLKGDRVGIWAVNCPEWVLVQYATARIGAIMVNINPAYRAHELAYVLRQAGISV
LVASLAHKSSDYRALVDQVREKCPELRETVYIGDPSWEALTAGAASVPYERLIAGAADLS
CDDPVNIQYTSGTTGFPKGATLSHHNILNNGYWVGRTVGYTEEDRVCLPVPLYHCFGMVM
GALGATSHGACIVLPAPSFDPAATLAAVQRERCTSLYGVPTMFIAELNLPDFASYDLSSL
RTGIMAGSPCPVEVMKRVVAEMHMAEVSICYGMTETSPVSLQTRRDDDLEHRTGTVGRVL
PHIEVKVVDPAGGVTVPRGTAGELCTRGYSVMLGYWDEPEKTAEAVDAGRWMHTGDLAVM
RENGYVEIVGRIKDMIIRGGENIYPREIEEFLYGHPKIADVQVVGVPHERYGEEVLACVI
PRDPADPPTLEELWAFCDGQLAHYKIPSRLRILDSFPMTVSGKVRKIELREQAAREGRDD
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgaactgtcgtacgcgcacgggacgagcacgacaccgctcctcggcgacaccatc
ggggcgaacctcgaccgggcgatcgccgcgtatcccgaccgtgacgccctcgtggacgtg
ccctccgggcggcgctggacctacgccgagttcggtgccgccgtcgacgaggtggcgctg
gggctgctcgccaagggcgtgctgaagggcgaccgggtcggcatctgggcggtcaactgc
cccgagtgggtgctcgtccagtacgcgaccgcccgcatcggcgcgatcatggtgaacatc
aatcccgcctatcgcgcccacgagttggcgtacgtcctccggcaggcggggatctcggtg
ctcgtcgcctcgctcgcgcacaagagcagcgactaccgcgccctggtcgaccaagtgcgt
gagaaatgccccgagttgcgggagacggtctacatcggcgacccgtcctgggaggcgttg
acggcgggcgcggcctcggttccgtacgagcggctgatcgccggcgcggccgacttgagc
tgtgacgacccggtcaacatccagtacacctcgggcaccacgggcttccccaagggggcc
accctctcgcaccacaacatcctcaacaacggctactgggtgggccgtacggtcggctac
accgaagaggaccgggtgtgcctgcccgtgccgctctatcactgcttcggcatggtcatg
ggagctttgggcgccacgtcgcacggcgcgtgcatcgtgctccctgccccttccttcgac
ccggccgccacccttgcggcggtccagcgggagcgctgcacgtccttgtacggcgtgccg
accatgttcatcgcggagttgaacctcccggacttcgcgtcgtacgacctctcctcgctg
cgcaccggcatcatggcgggctcgccctgcccggtggaggtgatgaagcgggtggtcgcc
gagatgcacatggcggaggtgtccatctgctacggcatgacggagacctcgccggtgtcg
ttgcagacgcgccgcgacgacgacctggagcaccgcaccggcaccgtcggacgcgtgctc
ccgcacatcgaggtcaaggtcgtcgacccggcaggcggggtgacggtgccgcgcggcacc
gcgggcgagctgtgcacccgcggctacagcgtcatgctcggctactgggacgaacccgag
aagaccgcggaggccgtggacgcggggcgctggatgcacacgggcgacctcgccgtgatg
cgcgagaacgggtacgtcgagatcgtcggccgcatcaaggacatgatcatccggggtggg
gagaacatctacccgcgcgagatcgaggagttcctgtacgggcatccgaagatcgccgac
gtacaggtggtcggcgtgccgcacgagcggtacggcgaggaggtcctggcctgcgtcatc
ccgcgcgatccggccgacccgccgacgctggaggagctgtgggccttctgcgacgggcag
ctggcccactacaagatccccagtcggctgcggatcctggactccttcccgatgacggtg
tccgggaaggtgcgcaagatcgaactgcgggagcaggcggcgcgggaggggcgggacgac
tga

DBGET integrated database retrieval system