KEGG   Streptomyces avermitilis: SAV_2307Help
Entry
SAV_2307          CDS       T00126                                 

Definition
(GenBank) putative acyl-CoA synthetase
  KO
K08295  
2-aminobenzoate-CoA ligase [EC:6.2.1.32]
Organism
sma  Streptomyces avermitilis
Pathway
Aminobenzoate degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sma00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    SAV_2307
Enzymes [BR:sma01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.32  anthranilate---CoA ligase
     SAV_2307
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NITE: 
UniProt: 
LinkDB All DBs
Position
2809477..2811261
Genome map
AA seq 594 aa AA seqDB search
MDPRNGTDPRNGTDPRNGTDSGNGTAPRDAVDDRRPTASAHVDTFARDHLPPPEQWPELH
FDLPELRYPERLNCAAELLGRTDAGRPAFRTADGDVWTYGQLRARVDRIAHVLTSRLGVV
PGNRVLLRGPTTPWLAACWLAVLKAGAVAVTVLAQQRPHELATMCGIARVTHALCDVRAV
DDLAKAEVPGLRLTTYGGDAPDDLLRLPAPDEAYPAVDTAADDVALIAFTSGTTGRPKGC
MHFHRDVLATADTFSKHVLRPQEDDVFAGSPPLGFTFGLGGLVVFPLRAGASALLLEQAG
PRQLLPAIAEHRVSVLFTAPTAYHAMLDELPAHDTGSLRRCVSAGENLPAATWRAWHERT
GLRIINGIGATELLHIFISAADERIRPGMTGVPVPGWHARVQDENGTPVPDGEPGLLAVR
GPVGCRYLADPRQREYVRGGWNVTGDTYVRDPDGYFRYVTRADDMIISAGYNIAGPEVED
ALLRHPDVTETAVVGRPDEARGQVVVAYAVLRAGARRDAEALGAFLRSELAPYKCPREFV
FLDALPRTATGKLQRFRLRDNRRTDVDSVPPEASVPAETSVPAEAPVPAEGDHE
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atggacccgaggaacggcacggatcccaggaacggcacggatcccaggaacggcacggac
tccgggaacggcacggccccccgggacgccgtcgacgaccggcggcccacggcctccgcc
cacgtcgacaccttcgcccgcgaccacctcccgccccccgaacagtggcccgaactccac
ttcgacctgccggagctgcgctaccccgaacggctgaactgcgccgccgaactgctcggc
cgcaccgacgccgggcgcccggcgttccgtaccgcggacggcgacgtctggacgtacgga
cagctgcgcgcccgcgtggaccggatcgcccatgtgctcacctcccggctcggtgtcgtc
cccggcaatcgcgtcctgctgcgcgggcccaccaccccctggctggccgcctgctggctg
gccgtgctgaaggcgggcgcggtcgccgtcacggtgctcgcccagcagcgtccgcacgag
ctggcgaccatgtgcgggatcgcgcgggtgacccacgccctgtgcgacgtacgggccgtc
gacgacctggcgaaggcggaggtccccgggctgcgcctcaccacgtacggcggcgacgcc
cccgacgacctgctgcgcctgcccgcaccggacgaggcgtacccggccgtggacaccgcg
gccgacgatgtcgcgctgatcgcgttcacctccggcaccaccggccgccccaaaggctgt
atgcacttccaccgggatgtgctggcgaccgccgacaccttctcgaagcatgtgctgcgg
ccacaggaggacgatgtcttcgcgggcagtcctccgctcggcttcaccttcgggctcggc
ggcctcgtcgtcttcccgctgcgggccggggcctcggccctgctgctcgaacaggccggt
ccccggcagctgttgcccgcgatcgccgagcaccgggtctccgtgctgttcaccgcgccg
accgcgtaccacgcgatgctcgacgagctgccggcccacgacaccggatcgctgcggcgc
tgtgtctcggccggtgagaatctgcccgccgccacctggcgggcctggcacgagcgcacc
ggcctgcggatcatcaacggcatcggcgccaccgagctgctgcacatcttcatctccgcg
gccgacgagcggatccggcccggcatgacgggcgttcccgtaccggggtggcacgcgcgc
gtgcaggacgagaacggcacgcccgtacccgacggcgagccgggactgctcgcggtgcgc
ggtcccgtgggctgccgctatctcgccgacccgcggcagcgggagtatgtgcggggcggc
tggaacgtcaccggtgacacctatgtccgcgaccccgacggctacttccgctatgtcacc
cgcgccgacgacatgatcatctcggccggctacaacatcgccgggccggaggtcgaggac
gccctgctgcggcacccggacgtgaccgagacggcggtcgtgggacggccggacgaggcg
cgcgggcaggtcgtggtggcgtacgcggtgctgcgggcgggcgcgcgccgggacgcggag
gcgctcggcgcgttcctcagatccgaactggcgccgtacaagtgtccgcgcgagttcgtc
ttcctggacgcgctgccgcgcacggcgacgggcaagctccagcggttccgcctgcgcgac
aaccgccgtacggacgtcgactccgtacccccggaagcctccgtccccgcggaaacctcc
gtacccgcggaagcccccgtgcccgcggaaggtgatcatgagtga

DBGET integrated database retrieval system